KEGG   Actinopolyspora erythraea: CDG81_04445Help
Entry
CDG81_04445       CDS       T05020                                 

Gene name
sodN
Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
aey  Actinopolyspora erythraea
Brite
KEGG Orthology (KO) [BR:aey00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CDG81_04445 (sodN)
Enzymes [BR:aey01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CDG81_04445 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: ASU77683
UniProt: A0A099D228
LinkDB All DBs
Position
complement(983699..984106)
Genome map
AA seq 135 aa AA seqDB search
MRLLSRLLGPRLEATAHCDLPCGVYDPAQARIEAESVKAIQEKYQNNEDPEFRTRAINIA
EQRSELVKHHLWVLWTDYFKPPHFEKYPQLHELVNKATKAAGAAGTKGSMDPATGQELLD
YIAEIDKIFWETKKG
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcgactcctgtcgcggcttctcggcccgcgtctggaagccactgcccactgcgacctg
ccgtgcggcgtgtacgacccggcccaggcgcggatcgaggccgagtccgtcaaggccatc
caggagaagtaccagaacaacgaggaccccgagttccgcactcgcgcgatcaacatcgcc
gagcagcgctcggaactggtcaagcaccacctgtgggtactgtggaccgactacttcaag
cctccgcacttcgagaagtacccgcagctgcacgagctggtgaacaaggccaccaaggca
gccggcgcggcgggcaccaagggctcgatggatcccgccaccggccaggagctgctggac
tacatcgccgagatcgacaagatcttctgggagaccaagaagggctga

DBGET integrated database retrieval system