KEGG   Actinopolyspora erythraea: CDG81_07010Help
Entry
CDG81_07010       CDS       T05020                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aey  Actinopolyspora erythraea
Pathway
aey00473  D-Alanine metabolism
aey00550  Peptidoglycan biosynthesis
aey01100  Metabolic pathways
aey01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aey00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CDG81_07010
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CDG81_07010
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CDG81_07010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aey01011]
    CDG81_07010
Enzymes [BR:aey01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CDG81_07010
Peptidoglycan biosynthesis and degradation proteins [BR:aey01011]
 Precursor biosynthesis
  Amino acid ligase
   CDG81_07010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: ASU80901
UniProt: A0A099D795
LinkDB All DBs
Position
1544158..1545249
Genome map
AA seq 363 aa AA seqDB search
MAERKVRVAVVFGGRSTEHGISCLSAGSVLAHLDRERFEVVPVGITRGGTWVLGPDDEER
LRINDRVEPEITDGRTLILPADPGSRELLSLESGSVGEVLSEVDVVLPMLHGAFGEDGTI
QGLLEMAGIPYAGPGVLASSAAMDKEFAKKLLAAEGLAVGTYEVLRRDETTLDERRRDRL
GLPVFVKPARAGSSVGITRVTDFAELDDAIAEARRTDPKVIVESALSGREIECGVLEFPD
GEITASAPAELRVEGGAGWYDYESKYLDDITEFDVPAKLSDEDAERLREAAVTAFRALDC
QGLARVDFFLTEDGQAVVNEVNTMPGFTSISLYPRMWAHAGIEYSTLLSILLDTAIARGT
GLR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacgcaaggtccgggtggccgtcgtcttcggcggacgcagcaccgaacacggt
atctcctgtctctccgccggtagtgtgctcgctcatctggaccgggagcgtttcgaggtc
gtccccgtcgggatcacgcgtggtggaacctgggtcctggggcccgacgacgaggagcgg
ctgcgcatcaacgaccgggtcgagccggagatcaccgacggcaggacactgatcctgccc
gccgatcccggcagccgtgagctgctctcgctggagtcgggcagcgtgggcgaggtactg
tccgaagtggatgtcgtgctgccgatgctgcacggcgccttcggcgaggacggcaccatc
cagggactgctcgaaatggcgggcatcccgtacgcggggcccggagtgctcgccagctcg
gccgccatggacaaggagttcgccaagaagctcctcgcggccgaggggctcgccgtcggt
acctacgaagtgctccgcagggacgagaccacactggacgagcgccgcagggaccggctg
gggctgcccgtgttcgtcaagccggcccgtgccggttcctcggtgggcatcaccagagtc
accgatttcgccgaactcgacgacgccatcgccgaggcacggcgcaccgaccccaaggtg
atcgtcgagtccgcgctgtccgggcgtgagatcgagtgcggtgtgctggagttccccgac
ggggagatcactgcctccgctccggcggagctgcgggtcgagggcggcgcgggctggtac
gactacgagtcgaagtacctcgacgacatcaccgagttcgacgtgcccgccaagctttcc
gacgaggacgcggagcggttgcgcgaggccgctgtcaccgccttccgcgccctggactgc
caggggctggcccgggtcgacttcttcctcaccgaggacgggcaagcggtggtcaacgag
gtcaacaccatgccggggttcacctcgatctcgctgtaccccaggatgtgggcacatgcc
ggtatcgagtactcgactctgctgagcatcctgctggacaccgccatcgcccgcggcacc
gggcttcggtga

DBGET integrated database retrieval system