KEGG   Actinopolyspora erythraea: CDG81_08310Help
Entry
CDG81_08310       CDS       T05020                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aey  Actinopolyspora erythraea
Pathway
aey00010  Glycolysis / Gluconeogenesis
aey00020  Citrate cycle (TCA cycle)
aey00620  Pyruvate metabolism
aey01100  Metabolic pathways
aey01110  Biosynthesis of secondary metabolites
aey01120  Microbial metabolism in diverse environments
aey01130  Biosynthesis of antibiotics
aey01200  Carbon metabolism
Module
aey_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDG81_08310
   00020 Citrate cycle (TCA cycle)
    CDG81_08310
   00620 Pyruvate metabolism
    CDG81_08310
Enzymes [BR:aey01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CDG81_08310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ASU80959
UniProt: A0A223RYU4
LinkDB All DBs
Position
1848462..1849739
Genome map
AA seq 425 aa AA seqDB search
MPRLSDTMEEGVISTWHKQVGDQINRGDVVAEIETDKAVMEMEAYDDGVLEKILVGEGET
VPIGVPIGLMGDGSGAAAAAGPSDSGAQESSAGSEDAEASTDSAAAETAPRTAALSSGES
GAEPHGRPKASPLARAVAREKGVDLSTVTGTGPGGRIIRVDIEAAAEAATDGAEQRRSQV
PESRPAERSEAEQRDPDLEEIPLSNIRKVTARRLTESKQQAPHFYLTSAVDVTDLVSFRA
DLNERLQASGGPKVSVNDLVVKACATALRANPSVNVSFRDEKLFQHKRVHLGVAVALDSG
LVVPVIPDADRKSVSEIAAEGKEKAERARDGKLKPDEMSGSTFSVSNLGMFGIEEFSAVI
NPPEAAILAVGATREEVQVHDGEFVVRKMMRMTLSADHRAVDGAVGAVFMQQLTSLLQDP
IRIIA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcctttccgacacgatggaggaaggcgttatctccacctggcacaagcaggtg
ggtgaccagatcaaccgcggcgacgtcgtggccgagatcgagaccgacaaggccgtcatg
gagatggaggcctacgacgacggggtgctggagaagatcctcgtcggcgagggggagacc
gtgcccatcggcgtccccatcggactgatgggggacggttcgggggccgccgcggcggcc
gggccctccgacagcggtgcccaggagtcgtcggccggttccgaggatgccgaggcgagc
accgactccgcggcggctgagaccgcaccccgcaccgcggctctctcctcgggcgagtcc
ggggcggagccgcacggccgtcccaaggcctccccgctcgcccgcgccgtcgccagggag
aagggggtcgacctctccactgtgaccggcaccgggcccggcgggcgcatcatccgggtc
gacatcgaggccgcggccgaggccgctaccgatggtgcggaacagcggcggtcgcaggtg
cccgagtcgcgccccgccgagcgttcggaagccgagcagcgggatccggacctcgaggag
atcccgctgagcaacatccgcaaggtcacggcccggcggctgaccgagagcaagcagcag
gcgccgcacttctacctgaccagcgccgtcgacgtcaccgacctggtctcgttccgcgcc
gacctcaacgagcggctgcaggcctcgggcggaccgaaggtcagcgtgaacgacctggtg
gtcaaggcctgcgccaccgccttgcgcgccaacccctcggtcaacgtctcgttccgggac
gagaagctgttccagcacaagcgggtccacctcggtgtcgccgtggcgctggactcggga
ctggtagtgccggtcatccccgacgccgaccgcaagagcgtctcggagatcgccgccgag
ggcaaggagaaggccgagcgagccagggacggcaagctcaagccggacgagatgtcgggg
agcaccttcagcgtgtccaacctgggcatgttcggtatcgaggagttctccgcggtcatc
aacccgccggaggccgccatcctcgccgtcggtgcgacccgtgaggaggtgcaggtccac
gacggcgagttcgtggtgcgcaagatgatgcgcatgaccctgtccgccgaccaccgcgcg
gtggacggcgccgtgggcgccgtgttcatgcagcagctcacctcgctgctgcaggacccc
atccggatcatcgcctga

DBGET integrated database retrieval system