KEGG   Actinopolyspora erythraea: CDG81_08950Help
Entry
CDG81_08950       CDS       T05020                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
aey  Actinopolyspora erythraea
Pathway
aey00250  Alanine, aspartate and glutamate metabolism
aey00410  beta-Alanine metabolism
aey00640  Propanoate metabolism
aey00650  Butanoate metabolism
aey01100  Metabolic pathways
aey01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CDG81_08950
   00650 Butanoate metabolism
    CDG81_08950
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CDG81_08950
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CDG81_08950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aey01007]
    CDG81_08950
Enzymes [BR:aey01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CDG81_08950
Amino acid related enzymes [BR:aey01007]
 Aminotransferase (transaminase)
  Class III
   CDG81_08950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ASU80975
UniProt: A0A099D7W0
LinkDB All DBs
Position
2007956..2009278
Genome map
AA seq 440 aa AA seqDB search
MNTEAGFDHGGEHARLARRRAAVMPSWLSTMYSEPIDIESGSGRHVWDAEGNRYLDFFGG
ILTTMTGHAVPEVTKAVSEQAGRILHSSTLYLNRPMVELAERIAELSGLDDPRVFFTTSG
TEANDTALLLATGYRSSNQILALRNSYHGRSFASLAVTGNRSWSPSSLSPVQTSYVHGTR
RRGTMLEGLADEEFTEACVRDLEDTLDQLHGNVACLIAEPIQGVGGFAAPPDGLFARFRE
VLDRHGILWISDEVQTGWGRTGEHFWGWQAHADNGPPDVVTFAKGIGNGLPIAGVVARGE
VMDSVAANSISTFGGSPLTAAGALANLDYHQRHDLQGNARRAGAVLRAELREAESLASVG
GIRGKGLMLGVELVRSDGGPAPETAAVVTERARERGLLIGKGGLEGNVLRVAPPLSVTEE
EAVEGARALVDALRAADSSA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgaggctggcttcgaccacggcggggagcacgcgcggctggcgcggcggcgc
gccgccgtgatgccgtcctggctatcgaccatgtactccgaaccgatcgacatcgagagc
gggtcgggccggcacgtgtgggacgcggagggcaaccgctacctcgacttcttcggcggc
atcctcacgaccatgaccgggcacgccgtaccggaagtgaccaaggcggtgtccgagcag
gcgggcaggatcctgcactcctcgacgttgtacctgaaccggccgatggtggagctggcc
gagcggatcgccgagctgtcgggcctggacgacccgagggtcttcttcaccacgagcgga
accgaggccaacgacaccgccctgctgctggccacgggctaccgttcctccaaccagatc
ctggcgctgcgcaacagctaccacggccgttcgttcgcctcgctggccgtgaccggcaac
cggagctggtcaccgagcagcctgtcgccggtgcagaccagctacgtccacggcacccgc
aggcgcggcactatgctggaggggttggccgacgaggagttcaccgaggcctgtgtacgc
gacctggaggacacgctcgaccagctccacggcaacgtggcgtgcctgatcgccgagccg
atccagggagtcggcggtttcgcggcgccccccgacggcctgttcgcgcgcttcagggaa
gtgctcgaccggcacggcatcctctggatcagcgatgaggtgcagaccggctgggggcgc
actggcgagcacttctggggctggcaggcgcacgccgacaacgggcctccggacgtcgtc
accttcgccaagggcatcggtaacggcctgccgatagccggggtcgtcgcccggggcgag
gtcatggacagcgtggcggcgaactcgatctccactttcgggggaagcccgctgacggcc
gccggtgcgctggccaacctcgactaccaccagcgtcacgacctgcaggggaacgcgcgg
cgggccggtgcggtactgcgcgccgaactccgggaggcggagtccctggcctcggtgggc
gggatccggggtaagggcctgatgctcggggtggagctcgtgcgttccgacggcggtccc
gctcccgagacggcggccgtggtcaccgaacgggcgcgcgagcgcggtctgctgatcggc
aagggaggactggagggcaatgtgctgcgcgtcgcacctccgttgagcgtcaccgaggag
gaagcggtcgaaggtgcccgtgcgctggtcgacgcgctgcgtgccgccgactcgtccgcg
tga

DBGET integrated database retrieval system