KEGG   Actinopolyspora erythraea: CDG81_09825Help
Entry
CDG81_09825       CDS       T05020                                 

Definition
(GenBank) hypothetical protein
Organism
aey  Actinopolyspora erythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactonase SGL
Motif
Other DBs
NCBI-ProteinID: ASU78531
UniProt: A0A099D9L9
LinkDB All DBs
Position
complement(2233285..2234415)
Genome map
AA seq 376 aa AA seqDB search
MSANPLSRRTLLASLGAAGTAAAVLPGSAAARVEGHLRPAYLGSFSWTDPPGRGLDVAAH
HLGTGELRPTHPVEGVPDASWLAFSPNRHVLYATNELVPDGSVTALSLRDPRNPRILNTR
SSRGGGPTHLSVHPSGRFLLTANYTDGTVVVHRLRPDGGLGESTDLVRHSSERREPHAHQ
VLTDPSGRWVVAVDLGADAVFTYRLDPESGRLRENQRLSLAAGSGPRHLAFRPDGGHAYL
VNELASTVTVLAWDAAKGTFEPGESVSTRPSGAEGENYPAEVVVTAAGDCYVTNRGDDEI
AHFEVRDGGARLRLVGTTGTGGAWPRHCALDGSGRWLYVANQNSGTVTRLPRDTVTGKPH
PVIEAVAAPGVAMVAL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgaatccgttgagccggcgtacgttactggcctccctgggcgccgcgggcacc
gccgccgcggtactgcccggttccgcggcggcgcgggtggaaggccacctcagacccgcc
tacctcggcagtttcagctggaccgacccgcccggcagggggctcgacgtggccgcccac
cacctggggacgggagagctgcgaccgacccacccggtcgagggagttcccgacgcgtca
tggctggcgttctcccccaaccgccacgtgctctacgccaccaacgaactggtcccggac
ggctcggtcacggcgctgagcctgcgcgacccgcgaaaccccaggatcctgaacacccgg
tccagccggggcggcggtcccacgcacctcagcgtgcaccccagcgggcgctttctgctg
acggccaactacaccgacggaaccgtcgtggtccaccggctgcggccggacggcgggctc
ggggagtcgaccgatctggttcggcactcctcggaacggcgcgaaccgcacgcccaccag
gtgctgaccgatccgagcgggcggtgggtcgtcgcggtagacctcggcgcggacgcggtg
ttcacctaccggctcgaccccgagtccggcaggctgcgggagaaccagcggctgtccctg
gcggcgggcagcggaccacgtcatctggccttccgaccggacggtgggcacgcgtacctg
gtcaacgagctggccagcaccgtgacggtactggcgtgggacgccgcgaagggcaccttc
gaaccgggcgagagcgtcagcacccgaccgagcggagccgagggggagaactaccccgcc
gaggtggtcgtgacagccgcgggggactgctacgtcacgaaccggggtgacgacgagatc
gcccacttcgaggtgcgcgacgggggagcacgactgcgcctggtgggcacgaccggcacg
ggtggggcctggccgcggcactgcgctctcgacggcagcggtcgttggctctacgtggcc
aaccagaactcgggcacggtgacccgcctgccgcgtgacacggtcactgggaaaccgcat
ccggtgatcgaggcggtggcggcccccggagtggcgatggtggcgctgtag

DBGET integrated database retrieval system