KEGG   Actinopolyspora erythraea: CDG81_10245
Entry
CDG81_10245       CDS       T05020                                 

Definition
(GenBank) 2-amino-4,5-dihydroxy-6-one-heptanoic acid-7-phosphate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
aey  Actinopolyspora erythraea
Pathway
aey00997  Biosynthesis of various secondary metabolites - part 3
aey01100  Metabolic pathways
aey01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aey00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    CDG81_10245
Enzymes [BR:aey01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     CDG81_10245
SSDB
Motif
Pfam: DeoC OMPdecase
Other DBs
NCBI-ProteinID: ASU78596
UniProt: A0A099D893
LinkDB
Position
complement(2328516..2329310)
AA seq 264 aa
MSGEDTSFARKLRMRRLHRHRSDRLFVVPLDHTVTQGPITGAGGLALLIHDLGKNGVDAV
VLHKGILRHIGADRFIDTSLIVHLSASTAHAPDPNAKYLVTSVEEALRLGADAVSVHVNL
GSAQEPQQITDLARVAEACDHWNLPLLAMMYVRGPEIKDPYSVELIAHAAGLAADLGVDV
VKAPYPGSAAEMAEVVKVCPVPLLVVGGPYTPNTDSLVSSVEDALTGGAIGAAVGRNIFQ
SPDPGAVAARLATRIHHGDDAGGW
NT seq 795 nt   +upstreamnt  +downstreamnt
atgtccggtgaagacacttcctttgcgcggaagttgcggatgcggagattgcaccggcac
cgctccgaccgattgttcgtggtgccgctggatcacacggtcacgcagggtccgatcacc
ggcgcaggaggacttgctctgctgatccacgacctcggcaagaacggggtggacgcggtg
gtgctccacaaggggatcctgcggcacatcggggctgaccgcttcatcgacacatcattg
atcgtgcacctcagtgccagcacggcgcacgcacctgacccgaatgcgaagtacctcgtg
acatcggttgaagaagccctgaggctcggggcggacgctgtcagtgttcatgtcaacctc
ggttcggcgcaggaaccccagcagatcaccgatctcgcacgggtggccgaggcatgcgac
cactggaacctgccgttgttggcgatgatgtacgtgcgcggccccgaaatcaaggatccg
tactccgtggaactcatcgcacacgcggctggtttggccgctgacctgggggtcgatgtg
gtcaaagctccataccccggatcagcagcggaaatggccgaggtagttaaggtctgtccg
gttccgctcctcgtcgtgggaggtccctacactccgaacaccgactcgctggtctcgtcc
gtcgaggacgcgttgaccggtggagccatcggtgccgctgttgggcgcaacatattccaa
tcgcccgaccccggagcggtcgcggctcgactggcgacacgcatacaccacggtgacgac
gcgggcggatggtga

DBGET integrated database retrieval system