KEGG   Actinopolyspora erythraea: CDG81_10930Help
Entry
CDG81_10930       CDS       T05020                                 

Definition
(GenBank) DUF1727 domain-containing protein
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
aey  Actinopolyspora erythraea
Pathway
aey00550  Peptidoglycan biosynthesis
aey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aey00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CDG81_10930
Enzymes [BR:aey01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     CDG81_10930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M
Motif
Other DBs
NCBI-ProteinID: ASU78705
UniProt: A0A099D6B5
LinkDB All DBs
Position
complement(2484381..2485739)
Genome map
AA seq 452 aa AA seqDB search
MTNTTRRGELTGPDQESTSSPPDPGQRWRVVAARRTDTESLPSRLRTGMALMAGRLATTT
SKRLRLGSGGIIGGRVAMALRPDLLDRLVADKRIVVVTGTNGKTTTTHMVAQALRAGGDS
VSNATGANMLDGHVAALMSEPAAPYAALEVDELHLAQLTDRFQPSVILLLNLSRDQLDRV
GEIRSVEASLRRALRQAPAAKVVANADDPNIVSAAIDHPHVTWVSGGCRWKHDALNCPRC
GAFLGELEGDWECACGLRRPAADWTVDSNGLVAPDGGVERLSLPLPGQVNRVNATFALAA
STELDLPRNESLERIQRLRDASGRYGHTTMAGRDVRLLLAKNPASWLEMLDLVAENERPL
ILVVNSRQADGHDVSWLWDIEFERLAGRTVLVTGERALDLAVRLRYAEVNCETASSVQQA
LHSATIEHSAGPVEIIANYTAFRDLFAKRQQH
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacacgacccgccggggtgaactgacggggcccgatcaggagagcacctcctcc
ccaccggatcccgggcagcggtggcgggtggtggcggcacgccgcaccgacacggaatcc
ctcccttcccggctgcgcaccggtatggctctcatggcgggaagactggccaccacgacc
tcgaaacggttgcggctgggaagcggcggcatcatcggcggcagggtggccatggcgctg
cggccggatctgctggaccggctggtggcggacaagcggatcgtggtcgtcaccggaacc
aacggcaagaccaccaccacgcacatggtcgcccaggcgctgcgcgcgggaggggattcg
gtcagcaacgccaccggggccaacatgctcgacgggcacgtcgcggcgttgatgtccgag
cccgccgcaccgtacgcggcgctggaggtcgacgagctgcacctggcgcagctgaccgac
cggttccaaccctcggtgatcctgctgctgaacctgagccgggaccagctcgaccgggtc
ggtgagatccgcagcgtcgaggccagtctgcgccgcgcgttgcggcaggcccccgcggcg
aaggtggtcgccaacgccgacgatcccaacatcgtctcggccgcgatcgaccatccccat
gtgacctgggtttccggcgggtgccgctggaagcacgacgcgctcaactgccccaggtgc
ggcgccttcctcggcgagctggagggggactgggagtgtgcgtgcggactgcgcagaccc
gctgctgactggacggtcgactcgaacggcctggtcgccccggacggcggggtcgaacgg
ctatccctgccgttgccggggcaggtcaaccgggtcaacgccaccttcgcgctcgcagcc
tccaccgagctggacctgccccggaacgagtcgctcgaacgcatccagcggttgcgggac
gccagcgggcgctacgggcacaccaccatggccgggcgcgacgtgcgcctgctgctggcc
aagaaccccgccagctggctcgagatgctcgacctggtcgcggagaacgagcgcccgctg
atcctggtcgtcaacagcaggcaggccgacggtcacgacgtctcctggctctgggacatc
gagttcgagcggttggcgggccggaccgtcctggtcaccggcgaacgagcgttggacctg
gcggtgcggctgcgctacgccgaggtgaactgcgaaaccgcttccagcgtgcagcaggcg
ctgcacagtgccaccatcgagcactcggccggaccggtcgagatcatcgcaaactacacc
gctttccgggatctgttcgcgaagaggcaacaacattga

DBGET integrated database retrieval system