KEGG   Actinopolyspora erythraea: CDG81_12940Help
Entry
CDG81_12940       CDS       T05020                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
aey  Actinopolyspora erythraea
Pathway
aey03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aey00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CDG81_12940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aey03400]
    CDG81_12940
Enzymes [BR:aey01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CDG81_12940
DNA repair and recombination proteins [BR:aey03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CDG81_12940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ASU79042
UniProt: A0A099D555
LinkDB All DBs
Position
2944845..2945756
Genome map
AA seq 303 aa AA seqDB search
MSERTLRAAGRPVEVSKADKVLFPEDGFTKDDIAEYYREVGHTVVRYTKERPLAAERYPD
GITGQRIFQKNASEHTPDWIRRFSAPKKEGGVTVHVVCDEPATLVYLSDQACLTPHVWPS
RVDALDFPDRLIFDLDPEGNDLETLRDAARSTRDLLEELALPSFVMTTGSRGFHVLAPLR
RHENFDEVRDFAGQVATVLAERKPGTLTVRQRKEERGNRVFVDYLRNAYGQTAVVPYSVR
ARPGAPVATPLRWDELSEVTPWEFTVRDIPARLHEHGDPWSDLGNHAHSLGRARNLLEHL
RTA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcggaccctgcgggcggcgggacgcccggtagaggtgtccaaggccgacaag
gtgttgttccccgaggacgggttcaccaaagacgacatcgccgagtactaccgggaggtc
ggccacaccgtcgtgcgttacaccaaggaacgccccttggcggcggaacgctacccggac
gggataacagggcagcgcatcttccagaagaacgcctccgaacacacgcccgactggatt
cgtcggttctccgcccccaagaaggagggcggtgtgacggtgcacgtggtgtgcgacgag
ccggccactctcgtgtacctgagcgatcaggcctgcctgacaccgcacgtgtggccgtcc
cgggtggacgcgctggacttcccggacaggttgatcttcgacctcgacccggagggcaac
gatctcgaaaccctgcgggacgcggcccgttccacccgtgacctgctggaggagctcgcg
ctgccctccttcgtcatgaccaccggctcccggggcttccacgtgttggctccgctgcgg
cggcacgagaacttcgacgaggtgcgcgacttcgccggacaggtggccaccgtcctcgcg
gagaggaaacccgggacgctgaccgtgcggcagcgcaaggaggaacgcgggaaccgcgtg
ttcgtggactacctgcgcaacgcgtacggacagaccgccgtcgtgccgtactccgtacgc
gccaggccgggagctcccgtggcgactccactgaggtgggacgagctttccgaggttaca
ccgtgggagttcactgtgcgcgacatcccggcgaggctgcacgagcacggcgatccctgg
tccgacctcggcaaccacgcccattccctgggacgtgcccggaacctgctcgaacatctc
aggacggcctga

DBGET integrated database retrieval system