KEGG   Actinopolyspora erythraea: CDG81_13130
Entry
CDG81_13130       CDS       T05020                                 

Definition
(GenBank) erythromycin biosynthesis sensory transduction protein eryC1
  KO
K13310  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase [EC:2.6.1.106]
Organism
aey  Actinopolyspora erythraea
Pathway
aey00523  Polyketide sugar unit biosynthesis
aey01100  Metabolic pathways
aey01110  Biosynthesis of secondary metabolites
Module
aey_M00797  dTDP-D-desosamine biosynthesis
Brite
KEGG Orthology (KO) [BR:aey00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CDG81_13130
Enzymes [BR:aey01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.106  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase
     CDG81_13130
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 AMP-binding Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: ASU79073
UniProt: A0A099D742
LinkDB
Position
complement(2990871..2991971)
AA seq 366 aa
MNVPFLDLQAAYLELRSDIDQAFQRVLGSGWYLHGPENEAFEVEFAAYCENTHCVTVGSG
YEALALSLLALGVGRGDEVIVPSHTFIATWLAVSRTGAVPVPVEPEELSHTLDPVLVEQA
ITPRTAAVLPVHLYGHPADLDALRAIADRHGLALVEDVAQAVGARHRGRRIGAGSTAAAF
SFYPGKNLGALGDGGAVVTTDHALAERVRALRNYGSKRKYVHEVRGTNARLDELQAAVLR
VKLRHLDDWNARRTTLARHYQTELANVAGITLPETHPWAESAWHLFVLRCADRERLQRHL
TETGVQTLIHYPVPVHLSTAYSDFGLPRGSFPIAETLAAEVLSLPIGPHLEREAADHVIT
TLKAAF
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgaacgtccccttcttggatctgcaagccgcctatctcgagctccggtccgacatcgac
caggcgttccagcgtgtgctcggttcgggctggtacctgcacgggccggagaacgaggcg
ttcgaagtggagttcgcggcctactgcgagaacacgcactgcgtgacggtcggcagcggt
tacgaggcgctggcactgagcctgttggcgctcggcgtcggccggggcgacgaggtgatc
gtgccttcgcacaccttcatcgccacgtggctcgccgtgtcgcgcaccggtgccgtgccg
gttcccgtggaaccggaggagctgagccacaccctcgacccggtactcgtcgagcaggcg
atcacgccgcgcaccgccgccgtcctgccggtgcacctctacggccaccccgctgatctc
gacgcgctccgcgcgatcgccgaccgccacggactggcgctggtggaggacgtcgcacag
gctgttggcgcccgccaccgcggccgccgcatcggtgcgggttccacggccgcggccttc
agcttctacccgggcaagaacctgggcgcgctgggggacggcggcgcggtcgtcaccacc
gatcacgccctggcggagcgcgtccgcgcgctgcgcaactacggttcgaagcggaagtac
gtgcacgaggtccgtggcaccaatgcgcgcctcgacgagctccaggcggcggttctgcgc
gtaaagctccgtcacctcgacgactggaacgcccggcgcaccacgctggcgcggcactac
cagacggagctggcgaacgtcgccggcatcacgctcccggaaacccacccttgggccgaa
tcggcttggcacctcttcgtcctccgttgtgcggaccgcgagcgtctccagcggcatctc
accgagacgggggtccaaaccctgatccactaccccgtccccgtccacctctcaaccgct
tacagcgacttcggtctgcctcgtggctccttccccatcgcggagaccctggcagcggag
gtcctcagcctccccattggcccccacctcgagagggaagctgccgaccacgtcatcacg
accctcaaagccgcgttctga

DBGET integrated database retrieval system