KEGG   Actinopolyspora erythraea: CDG81_13210
Entry
CDG81_13210       CDS       T05020                                 

Definition
(GenBank) dTDP-4-dehydro-6-deoxyglucose aminotransferase
  KO
K13308  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
aey  Actinopolyspora erythraea
Pathway
aey00523  Polyketide sugar unit biosynthesis
aey01100  Metabolic pathways
aey01110  Biosynthesis of secondary metabolites
Module
aey_M00797  dTDP-D-desosamine biosynthesis
Brite
KEGG Orthology (KO) [BR:aey00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CDG81_13210
Enzymes [BR:aey01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     CDG81_13210
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 SHMT
Other DBs
NCBI-ProteinID: ASU79087
UniProt: A0A099D5G7
LinkDB
Position
3036917..3038122
AA seq 401 aa
MKRALTDLAIFGGPEAFLHTLYVGRPTTGDRERFFARLEWALNNNWLTNGGPLLREFEGR
IADLASVRHCVATCNATIALQLVLRASDVSGEVIMPSMTFAATAHAVSWLGLEPVFCDVD
AESGLLDPEHVASLVTPRTGAIIGVHLWGRPASVEKLEKIAADNQVKLFFDAAHALGCTA
DGRPIGGFGNAEVFSFHATKAVTSFEGGAIVTDDGLLAERIRTMHNFGIAPDKLVSDAGT
NGKMSECAAAMGLTSLDAFAETRAHNRLNHALYSEELRDVRGISVHTFDPGEQNNYQYVI
ISVDSAAIDIDRDQLQAILRAEKVVAQPYFSPGCHQMQPYRTEPPLRLENTEQLSHRVLA
LPTGPAVSSEDIRRVCDIIRLAATNGELINARWDQRTRSGS
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgaagcgcgcgctgaccgacctggcgatcttcggcgggcccgaggcgttcctgcacacc
ctgtacgtgggcaggccgaccaccggggacagagagcggttcttcgctcggctggagtgg
gcgctgaacaacaactggctgaccaacggcggaccgctgctccgcgagttcgaggggcgg
atcgccgacctggcgagcgtgcgccactgcgtggccacgtgcaacgcgacgatcgcgctg
caactggtgctgcgcgccagcgacgtgtccggcgaggtcatcatgccctcgatgacgttc
gcggccaccgcgcacgcggtgagctggctggggctggaaccggtgttctgcgacgtcgat
gccgaaagcggactgctggatcccgagcacgtcgcatcactggtgacaccgcgcacgggc
gcgatcatcggtgtgcacctgtggggcaggcccgcatcggtcgagaagctggagaagatc
gccgccgacaaccaggtcaagctgttcttcgatgccgcgcacgcgctgggctgcaccgcg
gacggacggccgatcggcggtttcggcaatgccgaagtgttcagcttccatgccacgaag
gcggtcacctcgttcgaaggcggtgccatcgtcaccgacgacgggctgctggccgagcgc
atccgcaccatgcacaacttcgggatcgcaccggacaagctggtctcggatgccggcacc
aacggcaagatgagcgagtgtgccgcggcgatgggcctcacctcgctcgacgccttcgcc
gagaccagggcgcacaaccgcctcaaccacgcgctctactccgaggagctccgcgacgta
cgcggcatatccgtgcacacgttcgatcccggagagcagaacaactatcagtacgtgatc
atttcggtggactccgcggccatcgacatagaccgcgaccagttgcaggcgatcctccga
gcggagaaggttgtcgcacagccctacttctctcccgggtgccaccagatgcagccgtac
aggaccgagcccccgctgcggctggagaacaccgaacagctctcccaccgggtgctcgcg
ctgcccactgggcccgcggtgtccagcgaggacatccgacgggtgtgcgacatcatccgg
ctcgccgccaccaacggcgagctgatcaacgcgcgatgggaccagagaacgcgcagcggt
tcatga

DBGET integrated database retrieval system