KEGG   Actinopolyspora erythraea: CDG81_13225
Entry
CDG81_13225       CDS       T05020                                 

Definition
(GenBank) cytochrome P450
  KO
K14370  erythromycin 12 hydroxylase [EC:1.14.13.154]
Organism
aey  Actinopolyspora erythraea
Pathway
aey00522  Biosynthesis of 12-, 14- and 16-membered macrolides
aey01052  Type I polyketide structures
aey01100  Metabolic pathways
aey01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aey00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01052 Type I polyketide structures
    CDG81_13225
   00522 Biosynthesis of 12-, 14- and 16-membered macrolides
    CDG81_13225
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:aey01008]
    CDG81_13225
   00199 Cytochrome P450 [BR:aey00199]
    CDG81_13225
Enzymes [BR:aey01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.154  erythromycin 12-hydroxylase
     CDG81_13225
Polyketide biosynthesis proteins [BR:aey01008]
 Polyketide tailoring proteins
  Oxygenase
   CDG81_13225
Cytochrome P450 [BR:aey00199]
 Cytochrome P450, bacteria type
  CYP113 family
   CDG81_13225
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: ASU79090
UniProt: A0A099D456
LinkDB
Position
complement(3040194..3041387)
AA seq 397 aa
MTTIDEVPGMADETALLDWLGTMREKQPVWQDQYGVWHVFRHADVQSVLRDTATFSSDPN
RVIEGANPTPGMIHEMDPPEHRALRKVVSSAFTPRSISDLEPRIREVTRSLLEDADESFD
LVDVLAFPLPVTIIAELLGLPAMDHEQFGDWSGALVDIQMDDPTDPALAERIAEVLNPLT
KYLKDRCAERRSEPGDDLISRLVMAEVDGRVLDDEEAANFSTALLLAGHITTTVLLGNVV
RTLDEYPEYWRVAAEDPGRIPAILEEVLRYRPPFPQMQRTTTRATEVAGVPIPADVMVNV
WVLSANRDSDVHADPDRFDPSRGSGGAAQLSFGHGVHFCLGAPLARLENRVALEEIISRF
GRLTVDRADERLRHFDQIVLGTRHLPVLAPSSSTQSA
NT seq 1194 nt   +upstreamnt  +downstreamnt
ttgaccactatcgacgaagtccccggtatggccgacgaaacagcactcctcgactggctg
ggcacgatgcgcgagaagcagccggtgtggcaggaccagtacggcgtctggcacgtcttt
cgccacgccgatgtccagtcggtgctgcgcgacaccgccacgttctcctctgatcccaac
cgcgtcatcgagggtgcgaacccgacgccgggcatgatccacgagatggatccgccggag
caccgcgccttgcgcaaggtcgtcagcagtgccttcaccccgcgtagcatctccgacctc
gaaccccgcatccgcgaggtcacccgctcgttgctcgaagatgccgacgagagtttcgac
ctcgtcgatgtgctcgcgttcccgttaccggtcacgatcatcgcggagttgctgggactg
ccggcgatggatcatgagcagttcggcgactggtcgggcgccctcgtcgatatccagatg
gatgacccgaccgacccggcgctggccgagcggatcgcggaggtgctcaacccgctcacc
aagtacctgaaggaccgctgcgccgagcggcgttccgaacccggtgacgacctgatctcc
cgcctggtgatggccgaggtcgatgggcgtgtactcgacgacgaggaagcggccaacttc
tccaccgcgttgttgctggccggccacatcaccacgaccgtcctgctcggcaacgtcgtg
cgcaccctcgacgagtacccggagtactggagggtagccgccgaggatcccggcaggatc
ccggcgatcctcgaggaggtcctgcgctaccgcccgcccttcccgcagatgcagcgcacg
acgaccagggcgaccgaggtcgcgggggtgcccataccggccgacgtcatggtcaacgtc
tgggtgctctcggccaatcgcgactccgacgtccacgcggaccccgaccggttcgacccg
tcgcgcgggtccggcggcgccgcgcagctctccttcggccacggcgtgcacttttgcctc
ggagcgcccctggcgcggctggagaaccgcgtggcgttggaggagatcatctcccgattc
ggcagactcaccgtcgaccgcgcggacgagcgcctgcgccacttcgaccagatcgtgctc
gggacccgtcacctgccggtgctggcgccctcctcgtcgacgcagtcggcgtag

DBGET integrated database retrieval system