KEGG   Actinopolyspora erythraea: CDG81_15090Help
Entry
CDG81_15090       CDS       T05020                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
aey  Actinopolyspora erythraea
Pathway
aey00040  Pentose and glucuronate interconversions
aey00051  Fructose and mannose metabolism
aey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CDG81_15090
   00051 Fructose and mannose metabolism
    CDG81_15090
Enzymes [BR:aey01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     CDG81_15090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Pyr_redox_2 2-Hacid_dh_C HI0933_like
Motif
Other DBs
NCBI-ProteinID: ASU79390
UniProt: A0A099D5B6
LinkDB All DBs
Position
complement(3469306..3470319)
Genome map
AA seq 337 aa AA seqDB search
MRASVLRDVHDISVEDRPVPRPGPHEVLVRVSAVGTCGSDTHYYEHGRLGEFVVREPLVL
GHEASGTVVARGSEVSGHEPGTRVSLEPGVPCMACHECRSGRYNLCPDVRFFATPPVDGA
FCEYVTLHERFAYPVPEDMSDEAAALVEPLSVAVWACRKARVAPGDRVLVTGAGPVGLLA
AQTARAFGATEVVVTDVTGHRLRMASELAAADTVNVGERSLSATGYEPDVLLECSGNPGA
AAEAVGILARAGRAVFVGLGGDELALPLSHVQTREIELTGTFRYANTWPTAIALAASGAV
ELDGLVTHRFGLDRVPEALTLSARDDTAVKAVVRPQE
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcttccgtgctgcgcgacgtccacgacatctccgtcgaggatcggcccgttcca
cgtcccggcccgcacgaagtgctggtgcgggtgagcgcggtgggaacctgtggttccgac
acgcactactacgaacacggcaggctcggggagttcgtggtccgcgaaccactggtcctc
gggcacgaggcctccggcacggtcgtcgcccgtgggtccgaagtgtccgggcacgaaccc
ggcacccgggtctccctcgaaccgggggttccctgcatggcgtgccacgagtgccggtcg
gggcgctacaacctctgccccgatgtgcggttcttcgccaccccgcccgtcgacggggcg
ttctgcgagtacgtgaccctgcacgagcggttcgcctacccggtgcccgaggacatgtcg
gacgaggccgccgccctcgtcgaaccgctctcggtggccgtgtgggcgtgccgcaaggca
cgggtggcccccggggaccgcgtgctggtcaccggggccgggccggtcgggctgctcgcg
gcgcagaccgcgcgcgccttcggggccaccgaggtcgtggtgaccgacgtgaccgggcac
aggctgcggatggcctcggagctggccgccgccgacaccgtcaacgtcggtgagcggagc
ctgtccgccaccgggtacgaaccggacgtgctgctggagtgctccggcaaccccggggcc
gccgccgaggcggtgggcatcctggcccgcgccgggcgtgccgtgttcgtcggcctgggc
ggggacgaactcgccctcccgctctcgcacgtgcagacccgcgagatcgagctgaccggc
accttccggtacgccaacacctggccgaccgccatcgcgctcgccgcgtccggtgcggtg
gagctcgacgggctggtcacccaccggttcgggctggaccgggttcccgaggcgctcacc
ctgtccgcacgcgacgacacggcggttaaggccgtcgttcgcccccaggaatga

DBGET integrated database retrieval system