KEGG   Actinopolyspora erythraea: CDG81_16280Help
Entry
CDG81_16280       CDS       T05020                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
aey  Actinopolyspora erythraea
Pathway
aey00500  Starch and sucrose metabolism
aey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CDG81_16280
Enzymes [BR:aey01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CDG81_16280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 DUF1771
Motif
Other DBs
NCBI-ProteinID: ASU79571
UniProt: A0A223RUP4
LinkDB All DBs
Position
complement(3731239..3733392)
Genome map
AA seq 717 aa AA seqDB search
MGSPPKWGTWRGGRATVLPAAVLALVAGLVVGVPAGAAPSSAPGAPGISSAWTTGAKRGV
GTSTTLESKVWHTLGQGILNEVYYPRLDVPNVQDMQYVVTDGRSFTELERDATTREIRLP
DSRSLRYRQINTDRDGRYRITKTYVTDPRRSALLVRTRFEVLEGGPLRLYALYNPSLNGS
GMGDSGATSEGTLVASDGEVASALASSNGFGAATSGYSGTASDGYRDLETDHRLDNHYDR
AAEPGNLVQTARIPVGTDSTFTLALGFGADRAAAKSTARAALADGYDTARRGYDVGWHRY
LASIDHVPRSVASRGLITQYNVAAMTLKSQEDKTYRGAFVASTSIPWGGAKNADSCCTGG
YHLVWARDLYHTATAAMAMGDHAAANRALDYLLDVQWRQDGSFPQNTWLDGEPHWPSLQL
DEVAYPIVLAHQLGRTGDAEWAKLRESADFIVENGPATPQERWEEESGYSPSTIAAEIAG
LVTAADIARQHGDHRAARRYLATADEWQRKVEDWTFTTTGPHGDGEYYQRVDDDGDPNNG
HRLCLNNGGGCHDERAVVDAGFLELVRLGVKPADDQAVLDSLPETDERLRVLTPNGPGWY
RYNHDGYGEAAGGEPYTGEGIGRLWPLLTGERGEYEIASGDSAGTHLETMARMANEGYLI
PEQVWDRKSGDGFVFGEGTGSATPLAWSMSQFVQLAHNMDAGRNLDTPAVVAHRYTE
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgggatcaccgccgaagtggggaacgtggcgtggcggccgcgcgaccgtgctccccgcc
gcagtgctcgccctggtggccggcctggtggtgggagtaccggccggagcggctcccagc
tccgcgccgggtgctccgggcatctcctcggcgtggacgacgggggcgaagcgaggcgtc
ggtacttccaccacgttggagtcgaaggtctggcacaccctggggcagggaatcctcaac
gaggtctactacccgcgcctggacgtgccgaacgtgcaggacatgcagtacgtcgtcact
gacgggcgcagcttcaccgaactggagcgcgacgccaccacgcgtgagatccggttaccc
gactcgcgctcgctgcggtaccggcagatcaacaccgaccgcgacggcaggtaccgcatc
accaagacctacgtgaccgacccccggcgttccgccctgctggtccggacgcgtttcgag
gtgctcgaaggcggcccgttacggctctacgcgctctacaacccctccctgaacggcagc
gggatgggggacagcggagccacttccgaggggaccctggtcgccagcgacggcgaggta
gcaagcgcgctggcctcgtcgaacggattcggcgccgccacgagcggctacagcggtacc
gccagcgacggctaccgcgacctcgaaaccgaccaccggctcgacaaccactacgaccgg
gccgccgaacccggcaacctcgtgcagacggcgcgcattccggtcggcaccgacagcacc
ttcaccctcgcgctcggtttcggtgcggacagggcggcggcgaagtcgacagcacgggcc
gcgctggctgacggctacgacacggccaggcgcgggtacgacgtcggctggcaccgctac
ctcgcctcgatcgaccacgtaccccgctccgtcgcctcgcgcgggctgatcacccagtac
aacgtcgccgccatgacgctgaagtcccaggaggacaagacctaccggggtgctttcgtg
gcgtccacctcgatcccctggggaggcgccaagaacgccgacagctgttgtaccggtggt
taccacctggtctgggctcgtgacctgtaccacacggcgacggcggcgatggcgatgggt
gaccacgccgccgcgaaccgggcgctcgactacctgctggacgtgcagtggcgacaggac
ggttcgttcccgcagaacacctggctcgacggcgaaccgcactggccgagcctgcagctg
gacgaagtcgcctaccccatcgtgctggctcaccagctggggcggaccggcgacgcggag
tgggccaagctccgcgagtccgccgacttcatcgtcgagaacggtcccgccaccccgcag
gagcgttgggaggaggagagcgggtactctccctcgaccatcgcggccgagatcgcgggc
ctggtcaccgcggcggacatcgcccggcagcacggtgaccaccgagccgcccggcggtat
ctcgccaccgccgacgagtggcagcgcaaggtcgaggactggaccttcaccacgaccggt
ccgcacggcgacggcgagtactaccagcgcgtggacgacgacggtgatccgaacaacggc
caccggttgtgcctgaacaacggcggtggttgccacgacgagcgcgccgtggtcgacgcg
gggttcctggagctggtgcggctcggcgtcaaacccgccgacgaccaggcggtactcgac
tcgctgcccgaaaccgacgagcggctgcgggtcctgactccgaacggtcccggctggtac
cgctacaaccacgacggctacggcgaggccgccgggggcgagccctacacgggagagggt
atcggcagattgtggccgctgttgaccggcgagcgcggtgagtacgagatcgcttccggc
gactcggcaggtacccacctggagacgatggccaggatggccaacgagggctacctcatt
cccgaacaggtctgggaccggaaatccggcgacgggttcgtgttcggcgagggaacgggg
tcggccaccccgctcgcgtggtccatgagccagttcgtccagttggcccacaacatggac
gccggcaggaacctggacacaccggccgtggtggcccaccgctacaccgagtga

DBGET integrated database retrieval system