KEGG   Actinopolyspora erythraea: CDG81_19235Help
Entry
CDG81_19235       CDS       T05020                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
aey  Actinopolyspora erythraea
Pathway
aey00020  Citrate cycle (TCA cycle)
aey00480  Glutathione metabolism
aey01100  Metabolic pathways
aey01110  Biosynthesis of secondary metabolites
aey01120  Microbial metabolism in diverse environments
aey01130  Biosynthesis of antibiotics
aey01200  Carbon metabolism
aey01210  2-Oxocarboxylic acid metabolism
aey01230  Biosynthesis of amino acids
Module
aey_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aey_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:aey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDG81_19235
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CDG81_19235
Enzymes [BR:aey01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CDG81_19235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ASU80040
UniProt: A0A099DA29
LinkDB All DBs
Position
complement(4400414..4401634)
Genome map
AA seq 406 aa AA seqDB search
MSKIKVQGTVAELDGDEMTRIIWSFIKDKLIHPYLDINLDYYDLGVEHRDATDDQVTVDA
ANAISKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVIFREPIVISNIPRY
VPTWTKPIVIGRHAHADQYKATDFKVPGAGTVTVTYTPADGSEPMELEVANFPEQGGVAM
AMYNYRRSIEEFARASFRYGLERGYPVYMSTKNTILKAYDGVFKDVFEEVYENEFKADFE
ANGLTYEHRLIDDMVATALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTENG
TVEAEAAHGTVTRHYRRHQQGQETSTNPIASIFAWTRGLQQRGKLDSTPEVVEFAKTLEQ
VVIETVESGKMTKDLALLVGGDQPHQNTQEFLNTLDENLQKKMAQR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatcaaagtacaggggacggtcgccgagctcgacggcgacgagatgacccgg
atcatctggtccttcatcaaggacaagctgatccacccctacctcgacatcaacctcgac
tactacgacctcggggtcgagcaccgggacgccaccgacgaccaggtgaccgtcgatgcc
gccaacgcgatctccaagcacggtgtgggcgtcaagtgcgccaccatcactcccgacgag
gcgcgtgtcgaggagttcgggctcaagaagatgtggcgcagccccaacggcaccatccgc
aacatcctcggcggcgtgatcttccgcgagccgatcgtcatctccaacatcccgcgctac
gtgcccacctggaccaagccgatcgtcatcggcaggcacgcgcacgccgaccagtacaag
gccaccgacttcaaggttcccggcgcgggcaccgtgaccgtcacctacaccccggccgac
ggctccgagccgatggagctcgaggtcgcgaacttcccggagcagggcggcgtggcgatg
gccatgtacaactaccgccgctccatcgaggagttcgcgcgggcgtccttccgctacggg
ctggagcggggctacccggtctacatgtccaccaagaacacgatcctgaaggcctacgac
ggcgtgttcaaggacgtgttcgaggaggtctacgagaacgagttcaaggccgacttcgag
gccaacgggctcacctacgagcaccggctgatcgacgacatggtcgccaccgccctgaag
tgggagggcggctacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacacg
gtcgcgcagggcttcggctcgctcggcctgatgacctcggtgctgatgaccgagaacggc
acggtcgaggccgaggccgcccacggcacggtcacgcggcactaccgcaggcaccagcag
ggccaggagacctccaccaacccgatcgcctccatcttcgcctggacgcgcgggctgcag
cagcgcggcaagctggactcgacccccgaggtcgtcgagttcgccaagacgctggagcag
gtcgtcatcgagaccgtcgagagcggcaagatgaccaaggacctcgcgctgctggtcggc
ggcgaccagccgcaccagaacacgcaggagttcctgaacacgctggacgagaacctgcag
aagaagatggcccagcgctga

DBGET integrated database retrieval system