KEGG   Actinopolyspora erythraea: CDG81_21560Help
Entry
CDG81_21560       CDS       T05020                                 

Definition
(GenBank) NUDIX domain-containing protein
Organism
aey  Actinopolyspora erythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4
Motif
Other DBs
NCBI-ProteinID: ASU80428
UniProt: A0A099D9Q1
LinkDB All DBs
Position
complement(4906648..4907124)
Genome map
AA seq 158 aa AA seqDB search
MSKRDYYGDPQAPAANSLVVAVAVAVVVRDDSGRVLLIERTDNDLWALPGGAQDIGETTR
QAALREVAEETGLTVEITGIVGIYSDPRHVIAYDDGEVRQEFSIVFAARPAAGRLRPSSE
SRRVHWIQPEKLDSLTMHPTMRMRIEHAFQERSRPYLS
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcgggactactacggcgatccgcaggccccggcggccaacagtctggtggtg
gccgtggccgtggccgtggtggtccgcgacgattccggccgtgtgctgttgatcgagcgc
accgataacgacctgtgggcactgcccggcggagcacaggacatcggcgagaccacccga
caagccgccctgcgcgaggtcgccgaggagaccgggctgaccgtggagatcaccggcatc
gtgggtatctactccgacccgcgacacgtgatcgcctacgacgacggtgaggtccgccag
gagttctcgatcgtgttcgccgcccggccggcggcgggacgactacggcccagcagtgag
agccgccgcgtgcactggatccaacccgagaagctggattcgctgaccatgcaccccacg
atgcggatgcgcatcgagcacgcgttccaagagcgatccaggccgtatctcagctga

DBGET integrated database retrieval system