KEGG   Aeromicrobium sp. 592: C3E78_00765Help
Entry
C3E78_00765       CDS       T05410                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
aez  Aeromicrobium sp. 592
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AWB90878
UniProt: A0A2S0WHS6
LinkDB All DBs
Position
complement(163907..164908)
Genome map
AA seq 333 aa AA seqDB search
MEFSVLPYPQEPMLARTVHALPDEDDLPGGSVYEPKFDGYRAIVFVEGGHCRIQSRHGRD
ITRSFPDIAAAALESVPSGVVLDGELVVWGDNTSDFSELQRRLDGDVPVGLLDTRPASFI
AFDVLAGAGMDMRHSPLRVRRQALTILLGDVSAPLHLVPQTREVEEAEQWMANYAEANVG
VEGVVAKGLGTTYDGGERGWRKLRIQDSVECVVFAISGSLRAPRRLVLGRLAADGTAQVL
GCTTELTLPLSRRMGAHLARAAEDHPWADGLTSEDVPGWPEDLPAELHLVDPSTVVEVVA
DSLESGPWDDARELVRVRPELLATEVDAAGASG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtggagttctccgtgctgccgtacccgcaggagccgatgctcgcgcggacggtgcacgcc
ctgcctgacgaggacgacctgcccggcggctcggtctacgagcccaagttcgacggctac
cgcgccatcgtcttcgtggagggcggccactgccgcatccagtcccgccacggccgggac
atcacccggtccttcccggacatcgcggcggccgccctggagtccgtgccgtccggcgtc
gtgctcgacggcgagctcgtcgtctggggcgacaacacctcggacttcagcgagctgcag
cgtcgtctcgacggggacgtcccggtcggcctgctggacacgcgccccgcatcgttcatc
gcgttcgacgtgctggccggggccggcatggacatgcgccacagcccgctgcgggtccgc
cgccaggcgctcacgatcctgctgggcgacgtcagtgcgccgctgcacctcgtcccccag
acccgggaggtcgaggaggccgagcagtggatggccaactacgccgaggcgaacgtcggg
gtcgagggcgtcgtggccaaggggctcggcacgacgtacgacggcggtgagcgcggatgg
cgcaagctgcgcatccaggactcggtcgagtgcgtcgtcttcgcgatctccgggtccttg
agggcgccgcggcgactggtgctgggccgactcgccgccgacggcaccgcgcaggtcctc
ggctgcacgaccgagctgacgcttccgctgagccggcggatgggcgcccacctcgcccgg
gccgccgaggaccacccgtgggcggacggtctgacgtccgaggacgtccccggatggccc
gaggacttgccggccgagctgcacctggtcgacccgtctaccgtcgtcgaggtcgtggcc
gactcgctcgagtccggtccgtgggacgacgcgcgcgagctggtccgcgtccgacccgag
ctgctggcaaccgaggtcgacgcagccggcgcgtcgggctga

DBGET integrated database retrieval system