KEGG   Aeromicrobium sp. 592: C3E78_02860Help
Entry
C3E78_02860       CDS       T05410                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
aez  Aeromicrobium sp. 592
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AWB91245
UniProt: A0A2S0WIT4
LinkDB All DBs
Position
578256..579824
Genome map
AA seq 522 aa AA seqDB search
MCNDPCTQGQVVDCDPGYVRSAPANRQHRRDTVVTTTTSASAVRSFDQLFIGGEWVDSTG
SGRTDVISPSTGAVIAHIPDATEADIDKAVAAARAAFNGPWRDTTPADRGAALSRLADEI
EKRIPELAETFAHEVGAPLAVGTGFHALSVTMLRQFAAMHETTSFVEVREDGGDRVHIVR
EPVGVVGAIIPWNGPIAAATWKLGPALAAGCTVVLKPAPEGPLTTFILAECIEAAGLPAG
VVNIVPGGREVGEHLVTHPGIDKIAFTGSTAAGKRIASLCGESITRVTLELGGKSAAIVA
PDIDPADVIPTLVPAGIGHTGQVCAAITRILVPRERQAEYVEAITAALGSITVGDPFDPS
TALGPLAMERQRDRVEEYVEIGRQEGATVAVGGGRPAGLDDGFYFEPTLFTDVTNDMRIA
REEIFGPVITLIAYDGIDDAIAIANDSPYGLAGAVYSNDEAITTRVAREVRTGQMYVNNA
GMCVTQPFGGFKESGIGREGGPEGLAGYLETKMINFGQEANA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaacgacccgtgcacgcagggacaagtcgtcgactgtgacccaggttacgttcgg
tcggcaccagcaaaccgacagcatcgaagggacacagtcgtgacgacaactacctcagcc
tctgccgtgaggagctttgatcagctcttcatcggcggcgagtgggtcgactccaccgga
tccggacgcaccgatgtgatctcgcccagcaccggcgccgtgatcgctcacatcccggac
gcgaccgaggccgacatcgacaaggcagtcgccgcggctcgtgccgcgttcaacggtccg
tggcgcgacacgactcccgccgatcggggcgcggcgctctcgcggctggccgacgagatc
gagaagcgcatcccggagctcgccgagaccttcgcccacgaggtcggggcgcccctggcg
gtcgggacgggattccacgcgctctcggtcaccatgctgcgtcagttcgccgcgatgcac
gagacgacgtcgttcgtcgaggtccgtgaggacggtggcgaccgggtccacatcgtgcgg
gagcccgtcggagtcgtcggcgcgatcattccgtggaacggtccgatcgccgccgcgacc
tggaagctcggcccggccctggcggcaggctgcacggtcgtcctgaagccggcgcccgag
ggcccgctgacgacgttcatcctcgccgagtgcatcgaggccgcggggctgccggccggc
gtcgtcaacatcgtgccgggcggccgcgaggtcggcgagcacctggtcacccacccgggc
atcgacaagatcgccttcaccggaagcaccgccgcgggcaagcggatcgcgagcctgtgc
ggcgagagcatcacccgcgtgacgctcgagctgggcggcaagtccgccgccatcgtcgcg
ccggacatcgatccggccgacgtcatccccacgctcgtgccggccgggatcggccacacg
gggcaggtctgcgcggccatcacgcgcatcctcgtcccccgcgagcgtcaggccgagtac
gtcgaggccatcaccgccgcgctgggctcgatcacggtcggcgatcccttcgaccccagc
acggccctcggccccctcgcgatggagcgtcagcgcgaccgcgtcgaggagtacgtcgag
atcggccgtcaggaaggtgccaccgtggccgtgggcggagggcgtcctgccgggctcgac
gacggcttctacttcgagccgacgctgttcaccgacgtcaccaacgacatgcggatcgcg
cgcgaggagatcttcggcccggtcatcacgctcatcgcgtacgacggcatcgacgacgcc
atcgcgatcgcgaacgactcgccctacgggctggccggcgccgtctactcgaacgacgag
gccatcacgacccgcgtggcccgtgaggtgcggacgggccagatgtacgtcaacaacgcc
ggcatgtgcgtgacgcagccgttcggcggattcaaggagtccggcatcggacgtgaaggc
gggcccgagggcctcgccggatatctcgagaccaagatgatcaacttcggccaggaggca
aacgcatga

DBGET integrated database retrieval system