KEGG   Aeromicrobium sp. 592: C3E78_08355Help
Entry
C3E78_08355       CDS       T05410                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
aez  Aeromicrobium sp. 592
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AWB92209
UniProt: A0A2S0WLJ1
LinkDB All DBs
Position
1747601..1748686
Genome map
AA seq 361 aa AA seqDB search
MDLPVMPPIRPMLAKSVKGVPAADSVEGGLSYEPKWDGFRCIVFRDGDEVALASRSTKEL
TRYFPDVVAAILAETPERCVLDGEIFLAIDGRLDFDALSQRIHPAASRVTLLAEQTPASF
VAFDLLALGDESFMEAPFSERRARLEEGLAPASAPVHVTRTTTDAAVAEEWFGIFEGAGL
DGVVAKPLAKAYAPNGRQMLKIKHARTADVVVAGYRLHKTSTEERPLLGSLLLGLYADDG
LLQHVGVAASFTEARRAELIEELAPLVVDSADHPWGAWQDPDAQASSRLPGGQSRWSGTK
DLSFVTLRPDRVAEVGYEHMEGDRFRHTAQFKRWRPDRDPKSCTYEQLEEVAKYDLDEIL
T
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggatctccccgtgatgccgccgatccgaccgatgctggccaagtcggtcaagggcgtg
ccggccgcggactcggtcgagggcggcctgtcgtacgagccgaagtgggacgggttccgc
tgcatcgtgttccgcgacggggacgaggtcgcgctcgcgagccgctccacgaaggagctg
acccgctacttccccgacgtcgtcgccgcgatcctggccgagacccccgagcgctgcgtg
ctcgacggcgagatcttcctggccatcgacggccggctggacttcgacgcgctgtcgcag
cggatccacccggcggcgtcgcgggtcacgctgctcgccgagcagacgcccgcgtcgttc
gtcgcgttcgacctgctggcgctcggggacgagtcgttcatggaggcgccgttctcggag
cggcgagcacggctcgaggaggggctcgccccggcgtcagcaccggtccacgtcacccgc
accacgacggacgccgcggtggcggaggagtggttcggcatcttcgagggtgcggggctc
gacggggtcgtcgccaagccgctcgccaaggcgtacgcgccgaacggtcgccagatgctg
aagatcaagcacgcccgcaccgccgacgtggtcgtggccggctaccggctgcacaagacc
tcgaccgaggagcggccgctgctgggctcgctgctgctcgggctgtacgccgacgacggg
ctcctgcagcacgtcggcgtggcggcgtccttcaccgaggcacgccgcgcggagctgatc
gaggagctcgcgccgctcgtcgtcgacagcgccgaccacccgtggggcgcgtggcaggac
ccggacgcgcaggcgtcgtcacgactgcccggcgggcagagccgctggtcgggcacgaag
gacctctccttcgtcacgctcagacccgatcgtgtcgccgaggtcggctacgagcacatg
gagggcgaccgcttccggcacacggcacagttcaagcgctggcgcccggaccgcgacccg
aagagctgcacgtacgagcagctcgaggaggtcgccaagtacgacctcgacgagatcctg
acctga

DBGET integrated database retrieval system