KEGG   Alcaligenes faecalis ZD02: UZ73_03810Help
Entry
UZ73_03810        CDS       T04157                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
afa  Alcaligenes faecalis ZD02
Pathway
afa00020  Citrate cycle (TCA cycle)
afa00480  Glutathione metabolism
afa01100  Metabolic pathways
afa01110  Biosynthesis of secondary metabolites
afa01120  Microbial metabolism in diverse environments
afa01130  Biosynthesis of antibiotics
afa01200  Carbon metabolism
afa01210  2-Oxocarboxylic acid metabolism
afa01230  Biosynthesis of amino acids
Module
afa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
afa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:afa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UZ73_03810
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    UZ73_03810
Enzymes [BR:afa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     UZ73_03810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ALO37468
LinkDB All DBs
Position
complement(821432..822688)
Genome map
AA seq 418 aa AA seqDB search
MSYQHIKIPASGQKITVNADFSLNVPDQPIIPYIEGDGTGVDISPVMIKVVDAAVAKAYG
GKRKIEWMEVFAGEKSTKVYGSDVWLPEETLDAVKDYVVSIKGPLTTPVGGGIRSLNVAL
RQQLDLYVCLRPVRYFKGVPSPVREPEKTEMVIFRENSEDIYAGIEFAAESESAKKLIDF
LQTTLGVNKIRFPNTSGIGVKPVSREGTERLVRKAIQYAIDNDRSSVTIVHKGNIMKFTE
GGFRDWAYELAQKEFGAELIDGGPWCKFKNPKTGREIIVKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSLIL
SAEMMLRHMGWTEAADLIISSMEKSITSRKVTYDFARLMEGATQVSCSGFGDVMIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatcagcatatcaagatccccgcgtcggggcagaaaattacagttaacgcggat
ttttccctgaatgttcccgatcaacccattattccttacatcgagggtgatggtacgggc
gtggatatttcgccagtcatgatcaaagtggtcgacgctgctgttgccaaagcttatggc
ggcaagcgcaagatcgaatggatggaagtgttcgccggtgaaaaatccaccaaggtgtac
ggttccgacgtgtggctgccagaagaaacgctggatgccgttaaagactacgtcgtatcc
atcaaaggccctctgacgactcccgttggcggcggcatccgttccctgaacgtggccctg
cgtcagcaactggacctgtacgtctgcctgcgcccagtgcgctacttcaagggtgttcct
tcgcctgtgcgtgagccagaaaagaccgaaatggtcattttccgcgagaactccgaagac
atttacgccggtatcgaatttgctgctgaatccgaaagcgccaagaagctgatcgacttc
ctgcaaaccactctgggcgtgaacaagatccgcttccccaatacctccggtatcggtgtc
aagcctgtttcccgcgaaggtaccgagcgcctggtgcgcaaggccatccagtacgccatc
gacaacgatcgctcttccgtgaccatcgttcacaagggcaacatcatgaagttcaccgag
ggtggcttccgtgattgggcttacgaactggctcaaaaagaattcggcgctgaattgatc
gacggcggtccatggtgcaaattcaagaatcccaagaccggtcgcgagatcatcgtcaag
gattcgattgctgacgccttcttgcaacagatcctgctgcgtcctgccgagtacgacgtt
atcgccacactgaacctgaacggcgactacatctccgacgctctggctgctcaagtgggt
ggtattggtatcgcccccggcgccaacctgtccgactccgtggccatgttcgaagccacc
cacggtaccgctcccaagtacgctggcaaagactacgtgaacccaggttcgctgatcctg
tccgctgaaatgatgctgcgtcacatgggctggactgaagctgctgatctgatcatctcc
agcatggaaaaatccatcacctcgcgtaaagtgacatatgactttgcccgtctgatggaa
ggcgctactcaagtgtcctgctccggttttggcgatgtcatgatcgaaaacatgtaa

DBGET integrated database retrieval system