KEGG   Alcaligenes faecalis ZD02: UZ73_05020Help
Entry
UZ73_05020        CDS       T04157                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
afa  Alcaligenes faecalis ZD02
Pathway
afa00473  D-Alanine metabolism
afa01100  Metabolic pathways
afa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:afa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    UZ73_05020
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    UZ73_05020
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:afa01011]
    UZ73_05020
Enzymes [BR:afa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     UZ73_05020
Peptidoglycan biosynthesis and degradation proteins [BR:afa01011]
 Precursor biosynthesis
  Racemase
   UZ73_05020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ALO37681
UniProt: A0A0S2JNP0
LinkDB All DBs
Position
complement(1100673..1101803)
Genome map
AA seq 376 aa AA seqDB search
MPRPISATIHIASLRHNLDMVIQSLNNATAPSGVKRPHIWAVMKANAYGHDIENAVRAFS
AAEGMAMLDLKEAIRCRAAGWTGPIMLLEGFFQPEDLDVLAEFGLTTVIHCHEQLKMLEQ
WKGGVALNAMVKLNSGMNRLGFSVDDYPAAFERAQRLQKAGKLGTVGRMTHFARADDNID
ATLEQIRCFDRITDGLPGPVSVCNSAATLSPDLGAYMPSGPDHWVRPGICLYGSSPFADI
SADDFGLQPGMTLAAELISVRGVKQGEGIGYGHTYIAEQAMRVGVVACGYADGYPRHAGT
GTPITVNGVRTRLLGRVSMDMLAVDLTPVPAAGVGSQAVLFGQGGPSVDEVAAAAGTLGY
ELICAVAPRVPRIIQD
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgccacgtcctatctcggccaccattcatattgcgtcactgcgtcacaatctcgatatg
gttattcagagcctgaataacgccacggctccatccggcgtaaaacggccccatatctgg
gccgtcatgaaggccaatgcttacggtcatgacatcgaaaatgcggtgcgggcattcagt
gccgccgaaggcatggcgatgctggacctgaaagaagccatacgctgtcgggctgccggc
tggaccggccccatcatgttgctggaaggttttttccagcctgaagatctggatgtgctg
gccgaatttggcctgacgaccgtcattcattgccacgagcagctcaagatgctggaacag
tggaagggcggggtggccttgaatgccatggtcaagctcaatagcggcatgaatcgtctg
ggtttcagcgtggacgattatcccgctgctttcgagcgcgcccagcgtctgcaaaaagcg
ggcaagctgggcacggtcggtcgcatgacgcactttgcgcgcgccgacgacaatatcgat
gccacgctggagcagattcgctgctttgaccggatcaccgacggcttgcccggcccggtc
agtgtgtgcaattcagccgcaactctaagccctgacctgggggcctacatgccatccggt
ccggatcactgggtgcggcccggtatctgtttgtacggcagctctccttttgcggacatc
agcgccgatgacttcggtttgcagcccggcatgacgctggcagccgagctgatcagcgtg
cgcggcgtcaagcagggcgagggcattggttacggccatacctatattgccgagcaggcc
atgcgtgttggcgtggtggcttgcggctatgccgatggttacccgcgccatgcgggaacc
ggcacccccattaccgtcaacggtgtgcgtacccgtttgctcggtcgtgtctccatggac
atgttggcagtagacctgacgccggtgcccgccgccggtgtaggcagtcaggcggtgttg
ttcggtcaaggcgggcccagtgtggatgaggttgctgcggcagccggaaccctgggctac
gaattgatttgcgcggtcgccccacgtgtgccgcgcatcatccaggattaa

DBGET integrated database retrieval system