KEGG   Alcaligenes faecalis ZD02: UZ73_05375Help
Entry
UZ73_05375        CDS       T04157                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
afa  Alcaligenes faecalis ZD02
Pathway
afa00020  Citrate cycle (TCA cycle)
afa00310  Lysine degradation
afa00380  Tryptophan metabolism
afa01100  Metabolic pathways
afa01110  Biosynthesis of secondary metabolites
afa01120  Microbial metabolism in diverse environments
afa01130  Biosynthesis of antibiotics
afa01200  Carbon metabolism
Module
afa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
afa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:afa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UZ73_05375
  09105 Amino acid metabolism
   00310 Lysine degradation
    UZ73_05375
   00380 Tryptophan metabolism
    UZ73_05375
Enzymes [BR:afa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     UZ73_05375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: ALO37741
UniProt: A0A0M7C7J8
LinkDB All DBs
Position
complement(1178926..1180140)
Genome map
AA seq 404 aa AA seqDB search
MAITDVLVPQLSESISEATLLEWKKQPGEMVQADEILIEVETDKVVLEVPAPASGVLSEI
VKANGSTVTSGDVLARIDSEGKASAAAPAAAAEEAAPAAAPAAAAPAASSAASSVASPAA
AKILAEKGVEASSVEGSGRGGRITKGDALEANAAAAKPAAAPVAPPTLSLDGRPEQRVPM
SRLRARIAERLLQSQSENAMLTTFNEVNMQAVLDLRKKYKDQFEKEHGVKLGFMSFFVKA
AVAALKKYPVLNASVDGKDIIYHGYFDIGVAVGSPRGLVVPILRNADQMSIADIEKQIAD
FGARARDGKLTLEEMTGGTFSISNGGVFGSMLSTPIINPPQSAILGIHATKDRAVVENGQ
IVVRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPQRLLLNV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcaattactgacgttctggttccccaactctctgaatccatctccgaagcaaccttg
ctggaatggaaaaaacaacctggcgaaatggtccaggctgacgaaatcctgatcgaagtc
gaaaccgacaaggtcgttctggaagttcccgctcctgcttcgggcgtgctgagcgaaatc
gtcaaggccaacggcagcaccgttacctccggcgacgtgctggcccgtatcgactccgaa
ggtaaggctagcgctgctgctcctgccgccgctgctgaagaagccgctcctgctgctgcc
ccagccgctgcagctcctgctgccagctcggccgcctcttcggttgcttcgcctgcagct
gccaagatcctggctgaaaagggtgtggaagccagttccgtggaaggttccggccgtggt
ggtcgcatcaccaagggtgacgctctggaagccaacgccgctgctgccaaacctgctgcc
gctcctgttgcccctccaaccctgtccctggacggccgtccagaacagcgcgtgcccatg
agccgcctgcgcgctcgtatcgccgagcgtctgctgcagtcgcagtccgaaaacgccatg
ctgaccacgttcaacgaagtgaacatgcaagcggtgctggatctgcgcaagaagtacaag
gatcagttcgagaaagagcacggcgtgaaactgggcttcatgtccttcttcgtcaaggct
gctgttgccgccctgaagaaataccccgtgctgaacgcctcggttgatggcaaagacatc
atctaccacggttacttcgacatcggtgtggccgttggtagcccacgcggtctggtggtg
cctatcctgcgtaacgctgatcaaatgtccatcgctgacatcgaaaagcaaatcgctgac
ttcggtgcccgtgctcgcgacggcaagctgactctggaagaaatgacaggcggtaccttc
tccatctccaacggtggtgtgttcggttccatgctgtccactcccatcatcaacccacct
cagtccgccatcctgggcattcacgccaccaaggatcgcgctgttgtggaaaacggtcag
atcgtggttcgccccatgaactacctggctatgtcctacgaccaccgcatcatcgacggc
cgcgaagccgttctgggtctggtagccatgaaagaagcgctggaagatcctcagcgtttg
ctgctgaacgtctaa

DBGET integrated database retrieval system