KEGG   Alcaligenes faecalis ZD02: UZ73_06510Help
Entry
UZ73_06510        CDS       T04157                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
afa  Alcaligenes faecalis ZD02
Pathway
afa00071  Fatty acid degradation
afa00280  Valine, leucine and isoleucine degradation
afa00281  Geraniol degradation
afa00310  Lysine degradation
afa00360  Phenylalanine metabolism
afa00362  Benzoate degradation
afa00380  Tryptophan metabolism
afa00410  beta-Alanine metabolism
afa00627  Aminobenzoate degradation
afa00640  Propanoate metabolism
afa00650  Butanoate metabolism
afa00903  Limonene and pinene degradation
afa00930  Caprolactam degradation
afa01100  Metabolic pathways
afa01110  Biosynthesis of secondary metabolites
afa01120  Microbial metabolism in diverse environments
afa01130  Biosynthesis of antibiotics
afa01212  Fatty acid metabolism
Module
afa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:afa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    UZ73_06510
   00650 Butanoate metabolism
    UZ73_06510
  09103 Lipid metabolism
   00071 Fatty acid degradation
    UZ73_06510
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UZ73_06510
   00310 Lysine degradation
    UZ73_06510
   00360 Phenylalanine metabolism
    UZ73_06510
   00380 Tryptophan metabolism
    UZ73_06510
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UZ73_06510
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    UZ73_06510
   00281 Geraniol degradation
    UZ73_06510
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    UZ73_06510
   00627 Aminobenzoate degradation
    UZ73_06510
   00930 Caprolactam degradation
    UZ73_06510
Enzymes [BR:afa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     UZ73_06510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ALO37938
UniProt: A0A0M7BWC7
LinkDB All DBs
Position
complement(1438549..1439316)
Genome map
AA seq 255 aa AA seqDB search
MSELVTLERIGKVVLITLNRPEARNAINLETAQALAQALDEFDADPSIAVGVLTGANNTF
CAGMDLKAFAKTGQRPYVGDRGFAGICERPPAKPLIAAVEGYCLAGGFEIALSCDLIVAA
DSANFGLPEVKRGIVPGSGGMVRLPSRIPYHMAMEMVLTGGMYPAARMAELGLVSRLAEA
GKATEQALALAEQIAANGPLAVQTAKSIISQSRDWRQSDLFDLQRPRIAGIFTSADAKEG
ATAFAEKREPVWQGK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacttgtcacgcttgaacgtatcggcaaggtagtgttgattaccttgaaccgt
cccgaggcacgtaatgccatcaacctggaaaccgcgcaggcgctggcccaggctctggat
gagttcgatgccgaccccagtattgccgtgggcgtgctgactggtgccaacaatacgttc
tgcgccggtatggatttgaaagcctttgccaagactggccagcgtccctatgtaggtgac
cgcggctttgccggtatttgcgagcgcccgcctgccaagccattgattgccgctgtggaa
ggctactgcctggccggtggttttgaaattgccctgtcctgcgacctgattgttgcggcc
gacagcgccaactttggcctgcctgaagtcaaacgcggtattgtccccggatcgggcggc
atggtgcgtttgcctagccgtattccttaccacatggccatggaaatggtgctgaccggt
ggcatgtaccccgcagcccgcatggcagagctcggtttggtcagccgtctggccgaggct
ggcaaagccaccgagcaggccctggcactggccgagcagattgccgccaacggtcctttg
gccgtgcaaaccgccaagagcattatttcccagtcgcgcgactggcgtcagtcggatctg
tttgatctgcagcgccctcgtatcgccggcattttcacctctgcagacgccaaggaaggc
gcgacggccttcgctgaaaagcgcgagcctgtctggcagggcaaatag

DBGET integrated database retrieval system