KEGG   Alcaligenes faecalis ZD02: UZ73_06690Help
Entry
UZ73_06690        CDS       T04157                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
afa  Alcaligenes faecalis ZD02
Pathway
afa00473  D-Alanine metabolism
afa00550  Peptidoglycan biosynthesis
afa01100  Metabolic pathways
afa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:afa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    UZ73_06690
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    UZ73_06690
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    UZ73_06690
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:afa01011]
    UZ73_06690
Enzymes [BR:afa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     UZ73_06690
Peptidoglycan biosynthesis and degradation proteins [BR:afa01011]
 Precursor biosynthesis
  Amino acid ligase
   UZ73_06690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATP-grasp GARS_A ATPgrasp_Ter TTL ATPgrasp_YheCD ATPgrasp_ST ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ALO37970
LinkDB All DBs
Position
complement(1480382..1481332)
Genome map
AA seq 316 aa AA seqDB search
MTADFGRVGVLYGGKSAEREVSLMSGAGVHEALCSMGVDAHLFDMGEKGLTELAQAGFDR
VFIALHGRYGEDGTLQGALEWMGIPYTGSGVMASGLAMDKIMTKHVWQHLGLPTPGFAQL
DHVSQVAAAVERLGVPLIMKPPHEGSTVGVVRVDRAEEAVAAFETAMHYDTAVLAEQFIR
GRELTVPIIGVGAQARALPVIDIVAPQGNYDFEHKYYSDETQYFCPADLSPELTAHIQDL
SVRAFNALGCEGWGRADFMLDEQNRPWLLEMNTSPGMTSHSLVPMAAKAEGTSYAQLCVN
ILATARCKVQAIARSL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacagcggattttggtcgggtcggcgtgttgtacggcggcaagtccgccgaacgtgaa
gtgtccttgatgtctggtgcaggcgtgcatgaagccctgtgcagcatgggcgtggatgcg
catttgttcgatatgggcgagaaaggactgaccgaactggctcaggccggttttgaccgc
gtgtttattgctttgcatggtcgttacggcgaagacggcaccttgcagggagccctggag
tggatgggcatcccttacaccggcagcggggtgatggcctcgggcctggccatggacaag
atcatgaccaagcacgtctggcagcacctgggcttgccgacccccggctttgcgcagctg
gatcatgtcagccaggttgccgctgccgtggaacgtctgggcgtgcccctgatcatgaag
ccgccccatgaaggctccaccgtgggtgtggtgcgtgtggatcgcgccgaagaagccgtt
gctgcctttgaaaccgccatgcattacgacacggccgtgctggccgaacaattcattcgt
ggccgcgagctgacggtgcccatcattggtgtgggcgctcaggcacgcgccttgcccgtg
atcgacatcgtggcaccgcaaggcaattacgactttgaacacaagtattactcggacgaa
acccagtacttctgtcctgcagatctgtcgcctgagctgacggcgcatatccaggattta
tcggtccgtgcgtttaatgcactgggctgcgaaggctggggccgggccgatttcatgctg
gacgagcagaaccgcccctggctgctggagatgaacacctctcctggcatgaccagccac
tctttggtgcccatggcggccaaagcagaaggcaccagctatgcccagttgtgcgtgaac
attttggcaacggcgcgctgcaaagtgcaggccattgcccgcagcctatag

DBGET integrated database retrieval system