KEGG   Alcaligenes faecalis ZD02: UZ73_10460Help
Entry
UZ73_10460        CDS       T04157                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
afa  Alcaligenes faecalis ZD02
Pathway
afa00440  Phosphonate and phosphinate metabolism
afa01100  Metabolic pathways
afa01120  Microbial metabolism in diverse environments
afa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    UZ73_10460
Enzymes [BR:afa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     UZ73_10460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-ProteinID: ALO40368
LinkDB All DBs
Position
complement(2315442..2316266)
Genome map
AA seq 274 aa AA seqDB search
MTAMAAHNPLSARLAQDAGFGAIWGSGFELSASYAVPDANILSMGTHLEMMRAIASTVDI
PLIADIDTGFGNAVNVIYVIPLYEAAGASAIVMEDKTFPKDTSLRADGRQELVRIEEFQG
KIEAACAARRDPDFLIIARVEALIAGLGQEEALKRGLAYEQAGADAILIHSKQATPDQIL
SFVQAWTGKVPLVLVPTAYPQLTEADIAQLGKVGVVIYGNHAIRAAVGAMQAVFAQIRQD
GGIQNVDAGLPSVKTIIGLQGDAHMRQIEARFLR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaatggccgcacataatcccttgtctgcccgcctggctcaggatgccggtttc
ggggcaatttggggtagcggttttgagttgtcagccagttatgccgtgcctgacgccaat
atcctgtcgatgggaacccacctggagatgatgcgggcgatcgcctcgaccgtagacatt
cctttgattgccgatattgataccggctttggcaatgcggtgaatgtcatctacgtcatc
ccgctgtacgaagcagcgggcgccagtgccattgtgatggaggataaaaccttcccgaaa
gacaccagcctgcgggcggatgggcgtcaggaactggtacgcattgaggagttccagggc
aagattgaagcggcgtgcgcggcacgccgtgaccctgactttctgatcattgcgcgggtc
gaggccctgattgctggcctggggcaggaagaagccctgaagcgagggctggcttacgag
caggcgggtgcagatgccattttgattcactccaaacaagccacgccagaccagattctg
tcctttgtgcaggcctggaccggcaaggtgccgctggtgctggtgccaacggcctatcct
caactgaccgaggcggacattgcgcaactgggcaaggtgggcgtggtgatttacggcaat
catgcgattcgtgcggctgtaggggccatgcaagcggtgtttgcccagattcgtcaggat
ggcggcattcagaatgtggatgccgggctgccttccgtcaaaaccattattggtttgcaa
ggtgatgcccatatgcgtcagattgaggcccggtttctacgttag

DBGET integrated database retrieval system