KEGG   Alcaligenes faecalis ZD02: UZ73_11440Help
Entry
UZ73_11440        CDS       T04157                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
afa  Alcaligenes faecalis ZD02
Pathway
afa00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:afa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    UZ73_11440
Enzymes [BR:afa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     UZ73_11440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487 RbcS
Motif
Other DBs
NCBI-ProteinID: ALO38815
LinkDB All DBs
Position
2524576..2526036
Genome map
AA seq 486 aa AA seqDB search
MDNLKDVVFDNYIDGQWLPSQSGRTTPNLNPADRDDVVGAFPLSTAADAQAAVAAAQAAF
AGWRATPISTRARVLNAAAVWLDANVDRIAQGLTREEGKTLAQSKMEVGRSAQTLRFYAV
EGQTYTGETFPQDDAQQLVYTQREPLGVVSVIAPWNFPISIPARKIAPALITGNTVVFKP
SSDTPLTGYYLCEAFAQAGVPAGVLNLVHGRASEVGPTLVQSPQIRAISFTGSTQAGENI
CRQARMSTRTQMELGGKNPLIVMEDADLDLAVKLVIQGGFSLSGQACTGTSRVLVHRQIK
DEFTRRLVEKVSALTVGNGLNGTPDLGPIATESQLESILEYVAIGKQEATHLLGGERLTD
GDYARGLFMRPALFTDVTQQMRIAREEIFGPVIALLEIDSYEQALAMANDTEYGLSAAIV
TRSAEYAHRFANDIEAGTVKINRTTTGNLINAPFGGLKQSSTSTFRESGRAGLEFYTQIK
TVYRGI
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtggacaatctcaaggacgtcgttttcgacaattacattgatgggcagtggctgcccagc
cagagcgggcgcacgacgcctaatctgaatccggccgatcgggacgatgtggtgggagct
ttccctctgtccacggctgcggacgcgcaggccgccgttgctgctgctcaggccgccttt
gcgggatggcgagcaacgcctatctctactcgggcccgtgtgctgaatgcagcagcagtc
tggcttgatgccaatgtggaccgtatcgctcagggtctgacgcgggaagagggcaaaacg
ctggcgcaaagcaagatggaagtcggacgctcggcccagaccctgcgcttttacgcggtt
gaaggccagacctataccggcgagacattccctcaggacgatgcacaacaactggtctac
acccagcgtgaacctttgggtgtggtatccgtgattgcgccctggaatttccccatctcc
atcccggcacgcaaaattgcccccgccttgattaccggcaataccgttgttttcaagccg
tcgtctgacacgcccttgaccggctactacctgtgcgaagcctttgcacaagcaggggtc
ccggcgggtgtgctgaacctggtgcatggcagggccagtgaagtggggcccacgctggtg
caatcccctcagatacgcgccatttcgtttactggctcgacccaggcgggtgaaaacatt
tgtcgtcaggcacgcatgagcactcggacccaaatggagctgggcggcaaaaaccccttg
attgtcatggaagacgccgacctggatctggccgtcaaactggtgattcaaggcggattt
tccttgagcggtcaggcctgcacgggaaccagccgtgtgctggtgcaccgtcagatcaag
gatgaattcacgcggcgcctggtagagaaagtcagtgccttgactgtgggtaacggcttg
aatggcacccccgatctgggccccattgccaccgaaagccaactggaaagcattctggaa
tatgtggccatcggcaagcaggaagccacccatttactgggcggcgaacgcttgactgac
ggtgactacgcacgcggcctgttcatgcgcccggctttgtttacggacgtgacccagcag
atgcgtattgcccgcgaagagatttttggcccggtgattgccttgctggaaattgattcc
tacgagcaggcactggccatggccaatgacaccgaatacggcttgtctgccgccattgtg
acgcgcagtgccgaatatgcgcatcgctttgccaatgacattgaggccgggacggtcaag
atcaatcgcacgacaaccggcaacttgatcaatgctccttttggtggactgaaacagtcc
agcacttccaccttccgcgagtcgggtcgggcgggcctggagttctatacccagatcaag
accgtgtatcgcggtatctga

DBGET integrated database retrieval system