KEGG   Alcaligenes faecalis ZD02: UZ73_12650Help
Entry
UZ73_12650        CDS       T04157                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
afa  Alcaligenes faecalis ZD02
Brite
Enzymes [BR:afa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     UZ73_12650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ALO39037
UniProt: A0A2U2BIW4
LinkDB All DBs
Position
complement(2798546..2799094)
Genome map
AA seq 182 aa AA seqDB search
MRFSSFKARCAMALATVSATLALSAPSLADVIIPMNLATESGAGEQIGQVSVRQTEHGLV
FTPDLKNLKPGVHGFHIHENASCAPSEKDGKVTPAGAAGGHLDPNKTGKHGFPWGNGHLG
DLPALYVQADGSASTPVLAPRLKSLDQIKGRALMIHEGGDNHSDHPAPLGGGAGRFACGV
IK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttttcttccttcaaagcgcgatgcgcaatggccttggccaccgtcagcgccacc
cttgccttgtcggccccttcactggcggacgtcattattcccatgaatttggctaccgaa
agcggtgctggcgagcaaatcggccaggtcagcgttcggcagactgaacacggtctggtc
ttcacgccagatctgaaaaacctcaaacccggtgtacatggtttccatatacatgagaac
gccagctgcgcccccagcgagaaagacggcaaggtaacgcctgccggggcagccggcggc
catctggaccccaacaagaccggcaagcacggtttcccatggggtaatggccacctgggt
gatttgcccgccctgtatgtccaggccgacggcagtgccagcacccccgttctggctccg
cgcctgaagtcactggatcagatcaagggccgagccctgatgatccacgaaggcggtgac
aaccactccgatcaccctgcaccactgggcggcggtgccggacgttttgcttgcggagtg
atcaagtaa

DBGET integrated database retrieval system