KEGG   Alcaligenes faecalis ZD02: UZ73_15385Help
Entry
UZ73_15385        CDS       T04157                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
afa  Alcaligenes faecalis ZD02
Pathway
afa00564  Glycerophospholipid metabolism
afa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    UZ73_15385
Enzymes [BR:afa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     UZ73_15385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 Thi4 HI0933_like Lycopene_cycl Pyr_redox_3 XAF1_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ALO39524
LinkDB All DBs
Position
3406964..3408562
Genome map
AA seq 532 aa AA seqDB search
MTTLSSPLLTDRAQMLGALARTTQVDMVVVGGGATGLGVALDAALRGLSVVVLEAWDFAK
GTSSRATKLVHGGVRYLAQGNVSLVREALRERMHLLSNAPHLAQRLPFVMPSYKCWETPF
YGVGLMAYDGLAGREGLGHTQFLSASRIRQLLPGARQRGLKGGVKYWDGQFDDARLALAL
ARTAALNGALLVNYCPVMEVMHRDGKVSGVRCQDKESGQSYEIHSKCVVNATGVWVDQVR
QMDAQEAGRELRPMVSPSQGVHLVVDQEFLPGEHALLVPRTKDGRVLFAVPWLGKLILGT
TDTPRDDIPLEPRPLAQEVDFILKESANYLQKAPTVQDVRSIWVGLRPLVRPAAESAAGQ
TQSISREHSITVSANGLLTVTGGKWTTYRAMAEDVLERCQQSGLLGPLPACRTQEQRLVG
ASYVGDRRSLGRTAGLDAYGSEADWVQTLPGADQELAPGLSAAMVRFACRFEYARTVEDM
LARRSRLLFLDARLAQSIAPAVAAIMQEETGRSPELDAFLDLAEQYATVPVQ
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgactacattaagttcccccttattgaccgacagagcccagatgctgggcgctttggcg
cgcaccacgcaggtggatatggtcgtggtgggtggtggcgcaaccggcctgggtgtggcg
ctggatgcggccttgcgtggcttgagtgtggtggtgctggaggcctgggactttgccaaa
ggcacgtcctcgcgggcgaccaagctggtgcacggtggggtgcgatacctggcccaggga
aatgtcagcctggtgcgcgaggccttgcgcgaacgcatgcatttgctgagcaatgcgccc
catctggcgcagcgtctgccttttgtcatgcccagctacaagtgctgggaaaccccattt
tatggggtgggcctgatggcctacgacggtctggccgggcgggaagggctgggccatacc
caattcctgagtgcctccaggatccggcagcttctgcccggtgctcgtcaacgtggtttg
aagggcggcgtgaagtactgggatggccagtttgacgatgcccgtctggctttggcgctg
gcgcgtacggcagccttgaatggcgctttgctggtcaattactgtccggtaatggaagtg
atgcatcgcgacggcaaagtctccggagtgcgctgtcaggacaaggaaagtgggcaaagc
tacgagattcatagcaagtgcgtggtcaatgccaccggtgtctgggtagaccaggtccgg
caaatggatgcacaggaagccgggcgtgaattgcgccctatggtctcgcccagtcagggt
gtgcatctggtcgtcgatcaggagttcctgccgggtgaacatgccttgctggtgccgcgt
accaaggatggccgggtgttgtttgccgtcccctggttgggcaagctgattctggggaca
accgatacgccccgcgacgatattcctttggaaccacgtcctttggctcaggaagtggat
ttcattctgaaagagtccgccaactatctgcaaaaagccccaaccgttcaggatgtgcgc
agcatctgggtgggcttgcggcctctggtgcgtccggctgccgagtcggctgcggggcaa
acgcagtccatcagtcgggagcacagtattacggtcagcgccaatggcttgctgacggta
acgggcggcaagtggacaacctaccgcgccatggccgaggacgtgctggagcgctgccag
cagtccggtttgctggggccattgcctgcctgtcggacacaggaacaacgcttggtggga
gcctcttatgtgggcgaccgccgttctctgggccgtaccgctggcctggatgcttatggc
agtgaggctgactgggtacagaccttgccaggtgccgatcaagagctggctccgggtctg
agcgccgccatggtgcgctttgcctgccgtttcgaatacgcccgtacggtggaggatatg
ctggcccgccgttcgcgtctgctgtttctggatgcgcgtctggcacagtcaattgcgccg
gccgttgcggcgatcatgcaggaagaaacagggcgctcgcccgagctggacgcttttctg
gatttggccgagcaatacgccacagtacctgtgcagtaa

DBGET integrated database retrieval system