KEGG   Alistipes finegoldii: Alfi_0889Help
Entry
Alfi_0889         CDS       T02133                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
afd  Alistipes finegoldii
Brite
Enzymes [BR:afd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Alfi_0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Hist_deacetyl
Motif
Other DBs
NCBI-ProteinID: AFL77257
UniProt: I3YJT9
LinkDB All DBs
Position
complement(947544..948191)
Genome map
AA seq 215 aa AA seqDB search
MLNLIVSLLILPLMATDTAKQVRFTPKDLPYAYDALAPQVSEETLRFHHDKHYVGYVNKL
NELIVDTPYAEQPLEDIVVSADGAIFNNAAQMWNHEFFFDELSPKAQTRPTGALLKAIDD
NFGSFDQLKVQMEKAAAGLFGSGWVWLAEDKSGKLAIVSEQNAGNPLRYGMKPLMCFDVW
EHAYYIDYRNRRADAVAALWDRIDWKVVEERYAKK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacctcattgtttcactattaattttaccgcttatggcaacagacacagcaaaa
caggtgcgcttcactccgaaggacctgccttacgcttatgacgcgctcgcaccgcaggtc
tccgaagagacgctgcgcttccaccacgacaagcattacgtgggatacgtgaataaactc
aacgaactgattgtcgataccccctatgccgagcagccgctggaggatatcgtcgtttcg
gccgacggcgcgatcttcaacaacgccgcgcagatgtggaaccacgaattcttcttcgac
gaactttcgcccaaggcgcagacccgtcccacgggcgcgctgctgaaggccatcgacgat
aatttcggatcgttcgaccagctgaaggtccagatggagaaagccgccgcagggttgttc
ggttcgggctgggtatggctcgcggaggacaagtcgggcaagctggcgatcgtcagcgag
cagaacgccggcaatccgctgcgctacggcatgaagcccctgatgtgcttcgacgtttgg
gagcatgcttactatatcgactaccgcaaccgccgcgccgatgctgtcgcagccctctgg
gaccgcatcgactggaaggtcgtcgaagagcgctacgccaagaaatag

DBGET integrated database retrieval system