KEGG   Alistipes finegoldii: Alfi_1768Help
Entry
Alfi_1768         CDS       T02133                                 

Definition
(GenBank) glycosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
afd  Alistipes finegoldii
Pathway
afd00500  Starch and sucrose metabolism
afd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Alfi_1768
Enzymes [BR:afd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Alfi_1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AFL78098
UniProt: I3YM80
LinkDB All DBs
Position
complement(1982151..1983593)
Genome map
AA seq 480 aa AA seqDB search
MKNGVMMQYFEWNLPNDGKLWTQLKEDARHLHDVGVTSVWIPPAYKADEQQDEGYAVYDL
YDLGEFDQKGTVRTKYGTRQELEEAIAALHANGISVYIDTVMNQKTGADYTEKFMACEVD
PENREQVIGAPVEVEGWTGYTFPGRGDKYSPFKWHWYHFSGTDQVYETGKRAIYLIQGEG
KKWSEGVDGENGNYDFLIFNDVDFDHPEVIEEMKRWGAWIAQTLDADGMRLDALKHIRNT
FIGEFMHSVRASRGKEFYAVGEYWSGDFESLEAYLDAVDHQIDLFDAPLHFKLFTASQQG
RDFDLRTLLDDTLVRKHPTLAVTFVDNHDSQRGSSLESQVKSWFKPLAYGLILLMKEGYP
CIFYGDYYSMKGEASPHRAVLDILLDARRSRAFGEQTDYFDHPNTVGFTRAGDEQHPDSG
LALLLSNGEDGEKVMSVGVTHANETWHEITGSYDDEIVIGDDGKALFRVHGGKLAVWVKK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacggagtaatgatgcagtatttcgaatggaatctgcccaatgacggtaaattg
tggacgcagttgaaagaggacgcccgacacctgcacgacgtcggcgtcacctcggtctgg
atcccgccggcctacaaagccgacgaacagcaggacgagggatacgccgtctacgacctc
tacgatctgggcgagttcgaccagaaaggcaccgtccgcaccaagtacggcacgcgacaa
gagctggaggaggcgatcgcggcgctgcacgccaacgggatttcggtctatatcgacacg
gtgatgaaccagaaaaccggcgccgactacaccgagaagttcatggcctgcgaagtcgat
cccgaaaaccgcgagcaggtgatcggcgcccccgtcgaagtcgaaggctggaccggatat
acctttccggggcgcggcgacaagtactcccccttcaaatggcactggtaccacttctcc
ggaaccgatcaggtttacgagaccggcaagcgggccatctacctcatccaaggcgaaggc
aagaagtggagcgaaggggtagacggcgagaacgggaattacgacttcctgatcttcaac
gacgtggatttcgaccatcccgaagtgatcgaggagatgaaacgctggggcgcatggatc
gcccaaacgctcgatgccgacggcatgcgtctcgatgcgctcaaacacatccgcaacacc
tttatcggcgaattcatgcacagcgtccgggcttcgcgcggcaaggagttctacgccgtc
ggcgaatactggagcggcgatttcgagtcgctggaagcctacctcgacgccgtggaccac
cagatcgacctgttcgatgcgccgcttcacttcaaactcttcaccgcttcgcagcagggg
cgcgatttcgacctgcggacgctgctcgacgacaccctcgtgcggaaacatcccacgctc
gccgtgacgttcgtggacaaccacgactcgcagcgcggcagttcgctcgaatcgcaggtc
aagtcgtggttcaagccgctggcgtacggcctgatcctgctgatgaaggaggggtacccc
tgcatcttctacggcgactattacagcatgaagggcgaagcgtcgccccaccgggccgtt
ctcgacatactgctcgacgcacgccgctcgcgggctttcggcgagcagaccgactacttc
gaccatcccaacaccgtggggttcacccgcgcaggcgacgagcagcatccggattcggga
cttgcgctgctgctctccaacggcgaagacggcgaaaaggtgatgtccgtaggcgtaacg
catgccaatgagacgtggcacgagatcacgggaagctacgacgacgaaatagtcatcgga
gacgacggcaaggccctcttcagggtacacggaggaaaactggccgtctgggtcaaaaaa
taa

DBGET integrated database retrieval system