KEGG   Alistipes finegoldii: Alfi_2549Help
Entry
Alfi_2549         CDS       T02133                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
afd  Alistipes finegoldii
Pathway
afd00564  Glycerophospholipid metabolism
afd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Alfi_2549
Enzymes [BR:afd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Alfi_2549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 Lycopene_cycl FAD_binding_3 Pyr_redox_2 GIDA HI0933_like NAD_binding_8 Pyr_redox Pyr_redox_3 GMC_oxred_N Thi4 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AFL78816
UniProt: I3YP98
LinkDB All DBs
Position
complement(2880510..2882090)
Genome map
AA seq 526 aa AA seqDB search
MERLAQIKKLSEKDKVWDIVVVGGGATGLGVAVDAATRGMSVALLEKTDFAKCTSSRSTK
LVHGGVRYLQKGDVMLVLEALRERGRMKANAPHLVKDQAFVISNYRYWDNFLYFCGLTFY
DMLSFGFGYGRSKYISAKKVMKYIPTSVEKGLKGGVVYHDGQFDDSRMAVNLAQTCVENG
GTVVNQATVTGIVHDAAGRAAGVKFVDNLTGEEHTLKARSVVNAAGCFVDDIMHMDSPTH
RRMVTPSQGVHIVLDMKFLQSDYAIMVPKTSDGRVLFAVPWHDKVVVGTTDIVRPKAEED
PRPLKEEIDFILGTAGLYMNPAPTYKDILSVFAGQRPLAAPKKEGKNTKEISRSHKIIVS
DNGLVTITGGKWTSYRLMAEDTVDKAIEVAKLPARKCVTKKLHIHGYRKNPDLTDHMYVY
GSDEPKILELIKQQPELGEKLSPKYGYTYAEVLWAVREEMAMTVEDVLSRRVRLLFVDAR
EAMAAAPKVAQLMAKELGRDQAWIDGQVKDFTELAKTYIFAGEAEA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggaaagacttgcacaaatcaaaaaactatccgaaaaagacaaagtttgggatatcgtc
gtggtcggcggaggcgcaacgggtctcggcgtcgccgtcgatgccgcgacgcgcggcatg
agcgtggcgctgctcgaaaaaaccgactttgcgaaatgcacttcgagccgcagtaccaag
ctcgtacacggcggcgtccgctacctgcagaagggcgacgtcatgctggtgctcgaagcg
ctgcgcgaacgcggccgcatgaaggcgaacgccccccatctggtgaaagaccaagccttc
gtgatctcgaactacaggtattgggataattttctttatttctgcggtctgaccttctac
gacatgctttcgttcggtttcggctacggacgttcgaaatacatttcggcgaaaaaggta
atgaaatacattccgacttcggtcgagaagggtctgaaaggcggcgtggtgtaccacgac
ggacagttcgacgactcgcgtatggccgtgaacctcgcgcagacctgcgtcgaaaacggc
ggcacggtcgtcaatcaggctaccgtcacgggcatcgtgcatgacgcggcgggccgcgcc
gcaggcgtgaagttcgtggacaacctcaccggcgaggagcacacgctcaaagcgcgcagc
gtcgtaaacgccgccggctgcttcgtggacgacatcatgcacatggacagcccgacgcac
cgcagaatggtgacgccgagtcagggcgtgcatatcgtgctcgacatgaagttcctgcag
agcgactacgcaatcatggttcccaagacctcggacggccgcgtgctgttcgccgtgcct
tggcacgacaaagtcgtcgtcggcaccacggacatcgtacgccccaaggcagaggaagac
ccgcgcccgctcaaggaggagatcgacttcatcctcggcacggcgggactctacatgaac
ccggctccgacctacaaggatattctttcggtcttcgcgggccagcgtccgctggcggcg
cccaagaaggagggcaagaacacgaaggagatttcgcgcagccacaagatcatcgtatcg
gacaacggtctggttacgatcacgggcggcaagtggacctcgtaccgtctgatggccgag
gacacggtggacaaggcgatcgaagtcgcgaaacttccggcccgcaagtgcgtcaccaag
aaactgcacatccacggttaccgcaagaatcccgatctgacggatcacatgtacgtatac
ggcagcgacgagccgaagattctggagcttatcaagcagcagcccgaattgggcgaaaaa
ctctcaccgaagtacggctacacctatgccgaagtactctgggccgtacgcgaagagatg
gccatgacggtcgaagacgtgctttcgcgccgcgtacgcctgctcttcgtcgacgcccgc
gaagctatggccgcggctccgaaggtggcgcaactcatggccaaggaactcggacgcgat
caggcatggatcgacgggcaggtaaaagatttcacggaattggcgaaaacttatatcttt
gcaggcgaagccgaggcttag

DBGET integrated database retrieval system