KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_0483Help
Entry
Lferr_0483        CDS       T00758                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Brite
KEGG Orthology (KO) [BR:afe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:afe03012]
    Lferr_0483
   03029 Mitochondrial biogenesis [BR:afe03029]
    Lferr_0483
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:afe04147]
    Lferr_0483
Translation factors [BR:afe03012]
 Eukaryotic Type
  Elongation factors
   Lferr_0483
 Prokaryotic Type
   Lferr_0483
Mitochondrial biogenesis [BR:afe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Lferr_0483
Exosome [BR:afe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Lferr_0483
  Exosomal proteins of breast cancer cells
   Lferr_0483
  Exosomal proteins of colorectal cancer cells
   Lferr_0483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACH82737
UniProt: B5ELW5
LinkDB All DBs
Position
453886..455076
Genome map
AA seq 396 aa AA seqDB search
MSKGKFERTKPHVNVGTIGHVDHGKTTLTAALTKVLSAKFGGEIRAYDQIDNAPEERARG
ITIATSHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDAELLELVEMEVRELLSKYEFPGDDIPVIIGSALKALE
GDQSDIGEPAIFRLADAMDSYIPMPERPVDKPFLMPIEDVFSISGRGTVVTGRIERGIVK
IGDEIEIIGIHNTAKSIVTGVEMFRKILDQGQAGDNVGVLLRGTKKDDVERGQVLAKPGS
IKPHTRFEAEVYVLSKEEGGRHTPFFNGYRPQFYFRTTDVTGAVELPEGVEMVMPGDNIL
FKVALIAPIAMEEGLRFAVREGGRTVGAGVVSKVVE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagggaaatttgagcggacgaagccgcatgtcaacgtgggaacgattggtcac
gtggaccatggcaagaccacattaacggcggcgctgacgaaggtgttgtcggcgaagttt
ggcggtgagattcgcgcctatgatcagattgacaatgcgccggaagagcgggcgcgaggg
atcacgatagcgacctcgcacgtagaatacgagaccgcgaatcgtcactatgcccatgta
gactgtccggggcatgccgactatgtgaagaacatgattaccggagcggcgcagatggac
ggcgccatactggtgtgttcggcagcggacggtccgatgccgcagacccgcgaacatatt
ttgcttgcccgtcaggtgggcgttccctatatcgtcgtgtttttgaacaaggcggacatg
gtggatgacgccgagctgctggagttggtggaaatggaagtgcgcgaacttctgtccaag
tacgagtttcccggtgatgacattccggtgattatcggttcggcgctgaaggccctggaa
ggggatcagagcgacataggggagcctgcgattttccgtttggcggatgcgatggacagc
tacatcccgatgcccgagcgtcccgtggacaagcccttcctgatgccgatagaagacgta
ttttcgatttcgggtcgtggcacggtggtgaccggacgtattgagcgtggcattgtgaag
attggcgatgagatcgagatcatcggcattcacaacaccgccaagagcattgtcactggt
gtggagatgttccgcaagattctggatcaggggcaggccggagacaacgtcggggtactg
ctgcgcggcacgaagaaagatgatgtggagcgtggtcaggtactggccaagccgggcagc
atcaagccgcatacgcgttttgaagcggaagtatatgtgttgtcgaaagaggaagggggt
cgacacacgccgtttttcaatggttaccgcccgcagttttactttcgtaccactgacgtg
acgggtgcggtggagttgccggaaggtgtggagatggtgatgccgggcgacaatatattg
ttcaaggtcgcgttgattgcgccgattgcgatggaggaaggtctgcgtttcgcggtgcgc
gaaggcggccgtaccgttggcgccggcgtcgtctccaaggtggtcgaataa

DBGET integrated database retrieval system