KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1616Help
Entry
Lferr_1616        CDS       T00758                                 

Definition
(GenBank) protein of unknown function DUF81
  KO
K07090  uncharacterized protein
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Brite
KEGG Orthology (KO) [BR:afe00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Lferr_1616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ACH83838
LinkDB All DBs
Position
1576741..1577499
Genome map
AA seq 252 aa AA seqDB search
MQSLSTVWWVLPGLFLAGIGAGFINVLAGAGSMLTLPALIFVGLDPIAANGTNRIGILLE
NLTAARTFYHHNLVDLKMGIKLALWTLPGAMLGAIAGIHIGNLWFQRILVVVLAVSTATM
FLPKIVTGESTRPDGDASPWLYPTLLALGFYGGFMQLGIGFLFIFALRHFLTRDLAQVAA
YKTLIIALYTLPTLVIFAWMGQVHWGAGIVIGMGGMIGARLATRLTMSRRGKLWVKVIMA
IVILAMAARLWV
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcactcagcacagtatggtgggtccttcctggtttgttccttgccggtataggt
gccggatttatcaatgttctggcgggggcggggtccatgctgaccctgcctgcactcatt
ttcgtgggccttgatccaatcgccgcaaacggcaccaaccgcatcggcatccttttggaa
aacctcaccgctgcgcgcaccttttaccaccataacctggtggatctgaaaatgggaata
aagctggcgctatggacgttgccgggcgccatgctgggcgccattgccggtatccatatc
ggcaatctctggtttcagcgtatattggtggttgtactggcagttagcactgccacaatg
tttcttccaaaaattgttaccggagaatccacacgtccagatggtgatgcgtcgccctgg
ctctaccccacgctgctcgctctggggttttacggcggctttatgcagctcggtatcggt
tttctctttatcttcgcactgcgccattttctcaccagagatctcgcacaggtagctgct
tataaaaccctaattatcgcattgtacaccttgccgactctcgttatctttgcctggatg
gggcaggttcactggggtgcgggcatcgtcatcggtatgggtggtatgattggcgcgaga
ctggctacgaggcttaccatgagccgccgcggaaaactgtgggtcaaggtaataatggcg
atagtcatacttgcgatggctgccaggctttgggtttga

DBGET integrated database retrieval system