KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2108Help
Entry
Lferr_2108        CDS       T00758                                 

Definition
(GenBank) Glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00500  Starch and sucrose metabolism
afe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Lferr_2108
Enzymes [BR:afe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Lferr_2108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 Prenyltrans
Motif
Other DBs
NCBI-ProteinID: ACH84316
LinkDB All DBs
Position
2102733..2104811
Genome map
AA seq 692 aa AA seqDB search
MRHERRKTKETMSELPFGQPGLPSTWASAHKQAVGTALSERSRVWFTVADGVLTEVYHPT
IDCPNQRDLQFLITDGGELFHEERRDLEHSVEWIEDGIPAFQIVSRDPQGRYRLIKTVCT
DPDADCVLERVHFEPLVEAARHYRLYLLWAPHLDNQGSDNHGRVEYGANECDWLIAWRGS
RYAAVTATVPFSRMSAGYVGHSDGWQDINRHRHLEWNFTTAGPGNIALTAELELPPDGHF
MLCVGFGNSERTAIKAASGCLDRNGFASVLNRYMEGWRAYQRGLLDLSAQSGDGGQLYRR
SIAVLRTHIDKIHRGAGVASLSIPWGESASADQPIGGYHLVWPRDLYHQAMGLLAAGDRE
RPAQILHYLFSRQREDGSFFQNFWVDGRPYWQGLQLDEVGYSVLLANHLHHEGLLDFDPY
PVVQRAADFLVNHGPVTPQDRWEENRGYSPHTLAVVVAALRAAAAVADATGKGAQAVTYR
QVAQDWEQRIEDWTFTDCGRLLFGHPEHYERIALIPSVDTGEHLPECRVFLPIRNLPAEA
MYNQSQCCVVDGGFLELVRLGLRTAADLHVLKTLPVWDALCRRETPCGPAWYRYNGDGYG
EHEDGSPFDGTGRGRLWPLLTGERGHYEVAAGRDSRPYIKALECFANENGMLPEQVWDTE
PRLGHGTGSATPLVWAHAEYIRLLGASSRKGT
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
ttgcggcatgaacgtcgcaagaccaaggagaccatgagcgaacttccgttcgggcagcca
ggcctgcccagcacttgggccagtgcccacaagcaggctgtgggcactgccttgagtgaa
cgttcccgcgtctggttcaccgtcgccgacggtgtgttaaccgaggtttatcatccgacg
atcgactgtccgaatcaacgcgatcttcagttcctgatcaccgatggtggtgagctattt
cacgaagagcgacgcgatctggaacatagcgtcgagtggatcgaagacggcattccggcc
ttccagattgtcagccgagatccgcaaggccgctaccgactgatcaagacggtctgcacg
gatcccgatgccgactgcgtgcttgagcgagtccacttcgagcctttggtggaagcagcc
cgacattaccgcctgtatctgctgtgggcgccccatctcgacaaccaggggtcggataac
cacggtcgcgttgaatatggcgccaacgaatgcgactggctcatcgcctggcgcgggtct
cgatacgctgcggtaaccgccacggtacccttctcacgcatgtcagccggctatgtgggt
cattccgacggctggcaggatataaacagacaccggcacctagaatggaacttcacgaca
gcgggaccgggcaatattgcgctgacggcagaactggagttgccgccagacggtcatttc
atgctttgtgtcgggttcggcaacagcgagcggacggccatcaaggctgcaagcggctgc
ctggaccgcaacggattcgcgtcggttctcaatcgctacatggaagggtggcgcgcttat
cagcgcggattgctcgatctgtcggcccagagcggcgacggcgggcagctttaccggcgt
agcatcgcggtgttgcgtacgcatatcgacaagattcatcgcggcgcgggcgtggcctcg
ttgtccattccctggggcgaatcggcatcggcggaccagccgattggcggctatcacttg
gtctggccgcgcgatctctaccaccaggccatgggcttgctcgccgccggcgaccgggag
aggccagcgcagattctgcattatttgttctctcgacagcgcgaggatggaagcttcttt
cagaatttctgggtggatggcaggccctactggcaaggcctgcagctcgacgaagtcggc
tattcggtgctgttggccaaccacctgcaccacgaagggctcttggacttcgacccgtat
cccgtggtacagcgtgccgccgatttcctggtgaaccatgggccggtcaccccccaggac
cgctgggaggagaacagaggttacagtccccataccctggcggtagtggttgccgcgctg
cgcgctgcggcagcggtggccgatgcgaccggaaaaggggcgcaggccgtcacttaccga
caggtggcgcaagactgggaacaacgcatcgaggattggaccttcaccgattgcggtcga
ttgctcttcggccatcccgagcactacgagcgtatcgccctgatcccgtcggtcgacacc
ggtgagcatctgccagagtgtcgagtatttctgccaattcgcaatctaccagcggaagca
atgtacaaccagtcccaatgttgcgtggtagacggcggtttcctggagttggtacgcctg
ggtctgcgcaccgccgccgacctgcacgttctcaagaccctgccggtatgggatgcactg
tgccgacgcgagacgccttgcggaccggcgtggtatcgctacaacggggatggttacggt
gagcacgaggacggttcaccattcgatggtaccgggcgcggacgcttgtggccgttgctc
accggcgagcgcggacactatgaagttgccgccggacgcgactcccggccctacatcaag
gcgctggagtgctttgccaacgaaaacggcatgctgcccgagcaagtgtgggatacagaa
ccgcgtctgggccatggcacgggttcggccacacctctggtgtgggctcacgcggagtat
atccggctgctgggcgcttcgagtcgtaaaggaacatga

DBGET integrated database retrieval system