KEGG   Archaeoglobus fulgidus DSM 8774: AFULGI_00013420Help
Entry
AFULGI_00013420   CDS       T03231                                 

Definition
(GenBank) Putative regulatory, ligand-binding protein
  KO
K07228  TrkA domain protein
Organism
afg  Archaeoglobus fulgidus DSM 8774
Brite
KEGG Orthology (KO) [BR:afg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AFULGI_00013420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_C Castor_Poll_mid
Motif
Other DBs
NCBI-ProteinID: AIG98115
UniProt: A0A075WCK5
LinkDB All DBs
Position
1157475..1157945
Genome map
AA seq 156 aa AA seqDB search
MAIDLSGVGTKYEIDTPDGKVAVVFLDTGKIQLYILEKSCGKPCCVTLTAEEARRVASVL
SGSILEREEEGMELSLPGLAELRIAVHTYTVPKRLSGKSIGELGIRSKTGATVIAVLKKE
KTIISPSPETVLEPGDKVVVIGEKHQIENFEKFLRD
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagacctctccggcgtgggaacgaagtatgaaatagatactcccgatggcaag
gtagcggtcgtttttcttgacacgggtaaaatacagctttacattttggaaaaaagttgt
ggcaagccgtgctgcgtaactctaacggccgaagaggcaaggagagttgcaagcgttctt
tcgggctcaattctggagcgggaagaagagggtatggaactctcccttccgggacttgca
gaacttagaatagccgtccacacctacacagttccgaagaggctgtcagggaagagcata
ggtgagctgggaataagaagcaagacaggagcaacggtgatagcggttttgaagaaggag
aagacaataatcagcccctctccagaaaccgttcttgagcctggggataaggtggttgtc
ataggtgagaagcaccagatagagaacttcgagaagttcctcagggattga

DBGET integrated database retrieval system