KEGG   Archaeoglobus fulgidus DSM 8774: AFULGI_00019760Help
Entry
AFULGI_00019760   CDS       T03231                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
afg  Archaeoglobus fulgidus DSM 8774
Pathway
afg03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:afg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AFULGI_00019760
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:afg03400]
    AFULGI_00019760
Enzymes [BR:afg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AFULGI_00019760
DNA repair and recombination proteins [BR:afg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AFULGI_00019760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AIG98726
UniProt: A0A075WFF9
LinkDB All DBs
Position
complement(1704527..1705438)
Genome map
AA seq 303 aa AA seqDB search
MLAVRSKPFSSDDHIYEVKWDGTRCLAFVDVEGKRVRLQNRRLLDITYRYPEIKLLDAVE
RNAILDGEVVVIKDGKPSFPLLQKREHVDSRFKIEILSKTIPAVYIVFDVLYCDGWVVDL
ELMERKKILSEVLQSRGRVVVEEWIEGKGEEFYRKAVEMGLEGIVAKKKDGRYLIGKRSR
LWKKIKKRNTLDCVIVGWIEGEGERAKTFGSLVLAVYEDGRLKHVGNVGTGFDSEFLNWF
SERLREIEVAKPHFEIETKNVHWVKPRYVCEVEFLEFTEDGKLRAPVFLRLREDKSPDEC
RID
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctgtcaggtcaaagcccttcagcagcgacgaccacatttacgaggttaagtgg
gatggaacgaggtgcctcgctttcgttgatgtggagggaaagagggtcaggctgcagaac
agaaggctactggacataacctaccgctaccccgagattaaactgctggatgctgtcgag
agaaacgcgattctcgacggtgaggttgttgtgataaaggacggtaagccctccttccct
cttctgcagaaaagagagcatgtggacagcagattcaagattgagattctcagcaaaacc
attcccgcagtttacatagttttcgacgttctttactgcgacggctgggttgtggatttg
gagctgatggagaggaagaagatactctccgaagttctccaaagcaggggaagggttgtg
gtggaggagtggattgaaggtaaaggggaggagttctacagaaaagcggtggaaatgggg
cttgaagggattgtagcaaagaaaaaggatggaagatacttgataggcaaaaggagcaga
ctctggaagaagataaagaagaggaacacactggactgcgttatagtgggatggattgag
ggagagggagagagggcaaagacctttggctccctcgttctggctgtttacgaggatgga
aggcttaaacatgtcggcaacgttggtaccggctttgattctgagtttctgaactggttc
tcggagaggttgagggaaatagaggttgcaaagccgcacttcgaaatcgagaccaaaaac
gttcactgggttaagccgagatacgtctgcgaggtggagttcctcgagttcaccgaagac
gggaagctcagagcaccggtgtttctgagactgagagaggacaaaagtcccgatgaatgc
aggattgattaa

DBGET integrated database retrieval system