KEGG   Acidithiobacillus ferrivorans: Acife_1283Help
Entry
Acife_1283        CDS       T01595                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
afi00970  Aminoacyl-tRNA biosynthesis
afi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Acife_1283
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:afi03029]
    Acife_1283
Enzymes [BR:afi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Acife_1283
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Acife_1283
Mitochondrial biogenesis [BR:afi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Acife_1283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AEM47438
UniProt: G0JPW3
LinkDB All DBs
Position
1282923..1284353
Genome map
AA seq 476 aa AA seqDB search
MDWEVVIGLEVHAQLNTATKIFCGCPTTFGAEPNTHTCPVCLAMPGALPVLNAAAVDKAI
ALGLAIGAELNRHSIFARKNYFYPDLPKGYQISQYELPIVGKGSLTVQLSDGVEKVVGVT
RAHLEEDAGKSLHEAFIGQSGIDLNRAGTPLLEIVSEPDMRSPGEAVAYLKKLHALVRYL
DICDGNMQEGSFRCDANVSLRRPGAAYGTRAEIKNLNSFRFLEKAIEYEMVRQRDILESG
GHIVQETRLYDANRDETRSMRSKEEANDYRYFADPDLLPLVLNESRIERVRGTLPELPDA
KRTRFMRQYALTAYDAGVLTSGRVLADYYEQVAANVDGKLAANWVMGDLLGALNKAGVEI
ECCPVSAEKLRLLVQRIEDQTISGKIAKEIFEEIFYRGGEVDAIIDSRGLRQITDAAAIA
AMVDAIVTANPQQAADFRAGKDKLLGFFVGQVMKASQGKANPDQVNAILLERLQKS
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggattgggaagttgtcatcggcctggaagtccacgcccagctcaataccgccaccaaa
atattttgcggttgtccgaccactttcggggcagagccgaacacgcatacctgcccggtt
tgtctagcgatgcctggtgctctgccggtcctcaatgcagccgcagtggataaggctatt
gctctggggctggcgattggcgcggaactgaatcggcacagtatttttgcccgcaaaaac
tacttttacccagatctgcccaagggctatcagatcagccagtacgagttgcccatcgtc
ggcaaggggtcgctgacggtacagctgtcagacggggtggaaaaggttgtgggtgtcacc
cgtgctcaccttgaagaagacgctggtaaatcactgcacgaggcctttattggtcagtcc
ggcattgacctgaatcgtgcgggtacacctttgttggaaattgtgtcagagccagatatg
cggtcgccgggggaggcggtggcgtatctcaagaagctgcatgcactggtgcgttatctg
gatatttgtgatggcaatatgcaggaaggctccttccgctgtgacgctaacgtctccttg
cggcggccgggcgcagcatatggaaccagggcagagattaaaaatctcaactcctttcgg
tttttggaaaaggcgattgaatacgaaatggttcgccagcgcgatattctggagagcggt
ggtcatattgtgcaggaaacccgtctctatgatgccaatcgcgacgaaacccgctccatg
cgcagcaaggaagaagccaacgactaccgctattttgctgaccctgacctgctaccgttg
gtgctgaacgagtcgcgtattgagcgggtacgaggcacccttcctgagttgcccgatgcc
aagcggacccgctttatgcgtcagtacgcgctgaccgcctatgatgcgggggtgcttacc
tctggccgtgtcctggcggattactacgagcaggtggccgccaacgtggatggtaagctg
gcagcgaactgggtcatgggcgatctactcggcgccctcaacaaggcaggtgtggagatt
gaatgctgtccggtctctgcagaaaaactgcgtctgctggttcaacgtattgaggatcag
acgatttctggcaagatcgccaaagaaatctttgaagagattttctatcgcggtggcgag
gtggatgccatcattgatagtcggggtttgcggcagattaccgatgcggcggctattgcc
gcaatggtggacgccattgtcacggccaatccgcaacaggcggccgatttccgcgccgga
aaggacaaactgctgggcttctttgtggggcaggtgatgaaagccagtcaggggaaagcc
aatcctgatcaggtaaacgctattttgctggagcgtttgcagaaaagttag

DBGET integrated database retrieval system