KEGG   Acidithiobacillus ferrivorans: Acife_1420Help
Entry
Acife_1420        CDS       T01595                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
afi00620  Pyruvate metabolism
afi00680  Methane metabolism
afi00710  Carbon fixation in photosynthetic organisms
afi01100  Metabolic pathways
afi01120  Microbial metabolism in diverse environments
afi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acife_1420
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Acife_1420
   00680 Methane metabolism
    Acife_1420
Enzymes [BR:afi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Acife_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 T3SS_needle_F
Motif
Other DBs
NCBI-ProteinID: AEM47570
UniProt: G0JR37
LinkDB All DBs
Position
complement(1434170..1436959)
Genome map
AA seq 929 aa AA seqDB search
MEKTTINDKALRARVKLLGNLLGEVLREQAGARVFNAVEQLRQGYIRLHKKEDRRLRDRL
ARFIDALPQDDLVLVIRAFNTYFSLVNIAEEEFQHLHRRRLLQKKDGLWVGSFEETFREL
QNQGINSGQIQFLLDQTCYLPVFTAHPTESKRRTVLHGLRRIFVASKMLDDPSLNDEEEQ
DVLDNLKAQIQILWETEEVRANRPQVQDEVENGLFYFRDSLFEAVPRTYQAARRAARRVF
GNDDIDIPAFIRFGSWIGGDRDGNPNVTAAITGWALRTQSIEVLREYQRRLNDLYQLLGH
SSRFCAISPILLASLERDADDFPELAEWVDQRFPSEPYRRKLRYMMTRLDLRLRQLENGQ
VLNESSGPAYAAAEDFLDDLLLVRDSLRGHNDDYIADHEVQDIIWLVQTFGFHLANLDIR
QESTVHSRTIAELFAAVPSFANYLELPEETRLLVLSEALRRPGPLLEKQPDLSPMAAETC
AMFRCIAQLRREVSASGFGNYVISMTHEASHIMEVLVLAKEFGLAGWSRQGLYSEIAVTP
LFETIHDLERMDTVMSTLLDNPVYTEILRSQDDTQEVMLGYSDSCKDGGILSSSWTLYQA
QMRLAALADKRRIQVRVFHGRGGSVGRGGGPTYEAILAQPPDTVRGQIKITEQGEVLSFK
YANLETALYELTVGTAGLIKASIGLVRSVPSDNPDHLRIMAELTRTGEAVYRDLTENTPG
FMDYFYEATPLNEIAHMNIGSRPSHRQRGDRSMSSIRAIPWIFAWAQSRHILPAWYGLGS
ALAQWREDKPERLQALQDMYQQWPFFRALMSNIIMAMAKTDMAIAGEYAGLPRDQEVAAG
IYQKIRAEFERSLAEVLAMTGSTQLLADNPALAFSLQRRNVYMEPLNHIQLALLRRYRND
DAAPEFREIWLDPLLRTINAISAGQRNTG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaacgaccatcaatgacaaagcgctccgcgctcgcgttaaactgctcggcaat
ttgctgggcgaagtcctgcgcgagcaagccggagcccgggtattcaatgccgtagaacag
cttcgccagggatatatccggttgcacaaaaaagaggatcgccgcctgcgtgatcgtctc
gcgcgcttcattgatgcgctgccccaagatgatctcgtgctggtgatacgcgcattcaat
acctactttagcttggtcaacattgcggaagaagagttccagcatctgcatcgccgccgc
ttgctccaaaagaaggatgggctgtgggtcggttctttcgaggaaaccttccgcgaactg
caaaatcagggcatcaactccgggcaaatacaatttctcttggatcagacgtgctacctg
ccggtattcacggcacatcccaccgaatccaagcggcggacggttcttcatggtttacgc
cgcatctttgtggccagcaaaatgctcgacgatccatctctcaatgatgaagaagaacaa
gatgttctcgacaatttaaaggcgcaaatccagattctctgggaaaccgaggaagtgcgt
gccaatcgaccacaggtacaggatgaggtcgaaaatggccttttctacttccgcgacagc
ctctttgaagcggtaccgcgcacctatcaggcggcgcggcgtgcagcgcgacgggtcttt
ggcaatgacgatatcgatatcccggctttcatccgcttcggctcctggatcggtggtgac
cgcgatggcaatcccaatgtgacggcggccattaccggttgggccttacgtacccagagc
atcgaagtgttgcgtgaatatcagcgccgcttaaacgatctctaccagctgctcgggcat
tccagccgtttctgcgccatttctcccatcctgctggcctccctggaacgtgatgccgat
gacttcccggaactcgccgagtgggtggatcaacgttttcccagcgagccttatcggcgc
aaactgcgctatatgatgacgcgccttgatctgcgactccggcagctggaaaacggtcag
gtcctcaatgagtcctctggtccagcttatgcagccgcggaagatttcctcgacgatctg
ctgctggtgcgtgactccttgcggggccacaacgatgactacatcgccgatcacgaggtg
caggacattatctggctggttcagaccttcggctttcatctggccaatctggatattcgt
caggaatccaccgtacattcccgtaccatcgctgagcttttcgccgcagtgccgagcttc
gccaactacctggaactgccggaagagacccgcctgctggtgctctcggaagcactgcgc
cgacccggcccgctgctagaaaagcagcccgatctgtcgccaatggcggccgagacctgc
gccatgttccgctgcatcgcccagttgcgtcgtgaagtgagtgcatccggtttcggcaat
tatgtgatctccatgacacacgaggccagccacatcatggaagtgctggtactcgccaag
gagttcggcctggccggttggtcacggcaagggctctacagtgagattgccgtcacgcca
ctctttgagaccatccacgatctcgaacgcatggacacggtgatgtccaccttactggac
aacccggtttatactgaaatcctccgcagtcaggacgatactcaggaagtcatgctgggc
tattcggactcctgcaaggacggtggtatcctctcttccagttggaccctgtatcaggcg
caaatgcggctggctgccctggcggacaaacgccggattcaggtacgcgtcttccacggc
cgcggcggcagcgtggggcgtggcggcggccccacctacgaagccattctggcccagccg
ccggataccgtacgcggacaaatcaaaatcaccgaacagggagaggtgctctccttcaaa
tatgccaatctggaaacggcactttatgaactgaccgtgggcacggctggtctcatcaag
gcgagtattggtctggtccggtccgtacctagtgataacccggaccacctgcggattatg
gcggagctaacccgcaccggggaggcggtttaccgtgatctgactgaaaacacgccgggc
tttatggattatttctacgaggccaccccgcttaacgaaattgcccacatgaacatcggg
tcgcgtccctcccatcgccagcggggggaccgttccatgtcttctatccgggctatccca
tggattttcgcctgggcccaatcgcggcatattctgcccgcctggtatggactgggttcg
gcactcgcccagtggcgggaggacaagccggagcgcttgcaggctttacaggatatgtac
caacagtggccattctttcgggcactcatgagcaatatcatcatggccatggccaaaacg
gatatggctatcgctggcgaatatgccggtttacccagagatcaggaggttgccgccggc
atatatcagaaaattcgtgccgaattcgagcgcagcttggccgaggtgctcgccatgacc
ggatcaacgcaactactcgccgacaatccggccttggcattttccctgcaacgacgcaat
gtctacatggagccactcaaccatattcagctcgccttgctgcgtcgttatcgcaacgat
gacgcagcgcccgagttccgcgagatatggctggaccccctattgcgcaccatcaatgct
atttctgccggacagcgcaacaccgggtaa

DBGET integrated database retrieval system