KEGG   Acidithiobacillus ferrivorans: Acife_2822Help
Entry
Acife_2822        CDS       T01595                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
afi00473  D-Alanine metabolism
afi00550  Peptidoglycan biosynthesis
afi01100  Metabolic pathways
afi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Acife_2822
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Acife_2822
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Acife_2822
Enzymes [BR:afi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Acife_2822
Peptidoglycan biosynthesis and degradation proteins [BR:afi01011]
 Precursor biosynthesis
  Amino acid ligase
   Acife_2822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 RimK ATPgrasp_YheCD TTL ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AEM48897
UniProt: G0JSI9
LinkDB All DBs
Position
2792648..2793574
Genome map
AA seq 308 aa AA seqDB search
MSDLPRIAVLYGGPSGEREVSLSSGQAVLQALQGLGLNAVGIDIQPAILQQQLADSQAGI
VFNICHGAVGEDGLLQACLEMLNIPYTGSGVLASALAMDKWRCKQLWRAAGLPVTDGILL
RRGENAPDIGARFGWPLYIKPNHGGSSLGVSKVSGPEELDAALQSAFAIADEVLCEGAVI
GHEATVGILDDRALPPIVIETPRAFYDYTAKYLADDTRYLLPSGLGATLDQQLQAVALKA
FAELGGRDWGRVDFMISAEGQAYLLEVNSVPGMTSHSLVPMAAKAIGMDFPELCNAILRT
AQRRVKHG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatttgccgcgcatcgccgtcctctacggtggcccctcgggagaacgggaagtt
tctctcagcagtggccaggccgtgttgcaggctttgcagggactgggcctgaatgcagtg
ggtatcgacatccagcccgccatcctgcagcaacaactggcggacagccaggcgggcatc
gtcttcaatatctgccacggggcggtgggcgaagacggtctgctccaggcgtgcctggag
atgctgaatatcccttacaccggcagcggcgtgctcgcttccgccctcgccatggataaa
tggcgctgcaagcagctctggcgcgcagccggtttaccggtgaccgacggtatcctgctg
cgccgcggcgagaacgcaccggatattggcgcccgtttcggctggcccctgtatatcaag
cccaatcacgggggatccagcctcggggtcagcaaggtcagcggtccggaagaactggat
gcggccttgcagagcgcctttgcaattgcagacgaagtcctctgcgagggggccgtcatc
ggccacgaagccaccgtcggcatcctcgacgaccgtgccctgccgcctatcgtcatcgaa
acaccgcgcgccttctacgactacaccgccaagtatctcgccgacgatactcgctacctc
ctaccctcaggccttggtgccacactggatcagcaattgcaggcagtggcgctcaaggcc
tttgccgagctgggcggccgcgactggggacgcgtcgatttcatgatcagcgccgagggc
caggcatatctgctggaagtgaacagtgtacccgggatgaccagccatagcttggtcccc
atggccgccaaagcgatcggcatggatttcccggaattatgcaacgccatactgcgcact
gcgcagaggagagtgaaacatggttag

DBGET integrated database retrieval system