KEGG   Acidithiobacillus ferrivorans: Acife_3145Help
Entry
Acife_3145        CDS       T01595                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
afi00630  Glyoxylate and dicarboxylate metabolism
afi00710  Carbon fixation in photosynthetic organisms
afi01100  Metabolic pathways
afi01120  Microbial metabolism in diverse environments
afi01200  Carbon metabolism
Module
afi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:afi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Acife_3145
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Acife_3145
Enzymes [BR:afi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Acife_3145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AEM49213
UniProt: G0JL98
LinkDB All DBs
Position
complement(3070883..3072304)
Genome map
AA seq 473 aa AA seqDB search
MAVKKYEAGVKDYRQTYWAPEYMPLDSDILACFKITPQPGVDREEAAAAVAAESSTGTWT
TVWTDLLTDMDYYKGRAYRIEDVPGDDTCFYAFVAYPIDLFEEGSVVNVFTSLVGNVFGF
KAVRALRLEDVRFPLAYVKTCNGPPHGIQVERDKMNKYGRPMLGCTIKPKLGLSAKNYGR
AVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFVADAIRTAEAETGERKGHYLNVTAPSP
EEMYERAEFAKELNMPIIMHDFLTGGFCANTGLARWCRKNGILLHIHRAMHAVVDRNPHH
GIHFRVLAKALRLSGGDHLHTGTVVGKLEGDRGATQGWVDLLRESFVPEDRSRGIFFDQD
WGSMPGVFAVASGGIHVWHMPALLAIFGDDAIFQFGGGTLGHPWGNAAGAAANRVALEAC
VEARNEGRDLEREGKDILTNAAKDSPELKIALETWKEIKFEFDTVDKLDVVNR
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaaaaaagtatgaggccggtgtaaaggactaccggcagacctattgggccccc
gagtacatgcctttggattccgatatcctagcctgtttcaagattacgccgcaaccaggc
gtggatcgtgaagaagccgccgccgcggtggccgccgagtcttctaccggcacatggacc
acagtgtggaccgatttgttgactgacatggattactacaagggccgcgcctatcgcatt
gaagatgtgccaggcgatgacacctgcttttacgcttttgttgcctatcccatagatttg
tttgaagaggggtctgtggttaacgtcttcacctctttggtgggtaacgtgttcggcttc
aaggctgtgcgtgcgctgcgcctggaggatgtacgattcccgctcgcctacgtcaagact
tgcaatggaccgccgcacggtatccaggtcgagcgcgacaaaatgaacaaatatggccga
ccgatgcttggctgtaccatcaagcccaaactcggtctatctgccaagaattatggtcgt
gcagtctacgagtgtctgcgcggtggcctggatttcaccaaggacgatgagaacgttaac
tcgcagcccttcatgcgctggcgtgatcggtttctgtttgtggccgatgcgatccgcacc
gccgaagctgaaactggcgaacgcaaaggacattatttaaatgttacagcgccgtcgccc
gaggaaatgtatgaacgggcagagttcgccaaggaactcaatatgcccatcatcatgcac
gacttcctcacgggtggtttctgtgccaataccggtctggcgcgttggtgccggaagaac
ggcatcttgctgcacattcatcgtgccatgcatgcggtggtggaccgtaatccgcatcac
ggcatccacttccgtgtgctggccaaggcgctccgtttgtcgggtggtgatcacctgcat
accggcacagtggttggcaagttggaaggtgaccgcggcgccactcagggctgggtcgac
ctgctgcgcgagtcattcgtccccgaggaccgcagtcgcggcatcttcttcgaccaggac
tggggctccatgcctggagtattcgccgtggcttctggtggcatccacgtctggcacatg
ccagcgctattagccatcttcggcgacgatgcaatattccagttcggtggcggtacgctg
gggcatccatggggcaacgctgccggagccgctgccaatcgcgttgcgctggaggcctgt
gtagaagcgcgtaatgaaggacgtgatctggagcgcgagggcaaggacatcctcaccaac
gctgcgaaagatagtccggagttgaagattgctctggaaacctggaaagagatcaagttc
gagttcgacaccgtagacaagttggacgtagtgaaccgctga

DBGET integrated database retrieval system