KEGG   Acidithiobacillus ferridurans: AFERRID_02440Help
Entry
AFERRID_02440     CDS       T05847                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
afj  Acidithiobacillus ferridurans
Pathway
afj00970  Aminoacyl-tRNA biosynthesis
afj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AFERRID_02440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:afj03029]
    AFERRID_02440
Enzymes [BR:afj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AFERRID_02440
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AFERRID_02440
Mitochondrial biogenesis [BR:afj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AFERRID_02440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF2563
Motif
Other DBs
NCBI-ProteinID: BBF64026
UniProt: A0A2Z6IFE5
LinkDB All DBs
Position
complement(252223..253653)
Genome map
AA seq 476 aa AA seqDB search
MDWEVVIGLEVHAQLNTATKIFCGCPTAFGAEPNSHTCPVCLAMPGTLPVLNAAAVDKAI
ALGLAIGAELNRHSIFARKNYFYPDLPKGYQISQYELPVVGKGTLTVQLPDGGEKVVGVT
RAHLEEDAGKSLHEAFIGQSGIDLNRAGTPLLEIVSEPDMRSPAEAVAYLKKLHTLVRYL
DICDGNMQEGSFRCDANVSLRRPDAPYGTRAEIKNLNSFRFLEKAIEYEIVRQRDILESG
GRIVQETRLYDANRDETRSMRGKEEANDYRYFPDPDLLPLVLDEARIERVRATLPELPDA
KRIRFMRQYALPVYDAGVLTAGRTLADYYEQVAVGVDGKLAANWVMGDLLGALNKAGVEL
EDCPVSAGKLRLLVQRIEDQTISGKIAKDIFEELFHRGGEVDAIIDSRGLRQITDVAAIS
AMVDAIVTAHPQQAADFRAGKDKLLGFFVGQVMKASQGKANPDQVNAILLERLQKG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggactgggaagtcgtcatcggcctggaagttcacgctcagctcaataccgccaccaaa
atattttgcggctgtccgaccgctttcggggcggagcctaacagccacacctgtccggtc
tgtctagctatgcctggtaccctgccggtactcaatgcggcagcggtggataaggctatc
gctctagggctggcgattggcgcggagctgaatcggcacagtatttttgcccgcaagaac
tatttttaccccgatctgcccaagggctatcagatcagccagtacgagctgcccgtcgtc
ggcaaggggacactgacggtgcaactacccgacggtggggaaaaggtagtgggcgtgacc
cgcgcccacctggaagaagacgccggtaaatcacttcacgaggccttcatcggacaatcc
ggcatcgacctgaaccgtgcgggcacgccgttgctggaaatcgtgtccgagccggatatg
cgctcgccggctgaggcggtggcctatctcaaaaaactgcataccctggtacgttatctg
gatatttgtgatggcaatatgcaggaaggctcctttcgttgtgatgccaacgtctccctg
cggcggccggacgccccctatgggacccgtgccgagatcaagaatctcaactctttccgg
tttctggaaaaggcgatcgaatatgagatcgttcgccagcgcgacatcctggagagtggc
ggccggattgtgcaggaaacacgtctctatgacgccaaccgcgacgaaacccgctccatg
cgcggtaaagaagaagccaacgattatcgctattttcccgacccggatctgttaccgctg
gtgttggacgaggcgcgtatcgagcgggtgcgggcgactctcccggagttgcccgatgcc
aagcgtatccggtttatgcgtcagtatgcgctgccggtctatgacgctggcgtgctcact
gctggccgtaccctggcggattactacgagcaggtagccgtcggtgtggatggtaaactg
gcggcgaactgggtcatgggcgacctgctcggggccctcaacaaggcgggcgttgagctt
gaggactgtccggtctcggccgggaaactgcgcctgctggtccagcgtatcgaagatcaa
acgatctctggcaagatcgccaaggatatctttgaagagctttttcatcgtggtggtgag
gtggatgccattattgacagccggggactgcggcagatcaccgatgtggcggctatttcc
gcaatggtggacgccattgtcacggcccatccgcaacaggcagccgactttcgcgccggg
aaggacaagctgctgggcttttttgtgggtcaggtgatgaaggctagtcagggaaaagcc
aatccagatcaggtaaacgctattttgctggagcgtttgcagaagggttag

DBGET integrated database retrieval system