KEGG   Acidithiobacillus ferridurans: AFERRID_05540Help
Entry
AFERRID_05540     CDS       T05847                                 

Definition
(GenBank) Glutathione S-transferase GST-6.0
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
afj  Acidithiobacillus ferridurans
Pathway
afj00480  Glutathione metabolism
afj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AFERRID_05540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:afj02000]
    AFERRID_05540
Enzymes [BR:afj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AFERRID_05540
Transporters [BR:afj02000]
 Other transporters
  Pores ion channels [TC:1]
   AFERRID_05540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N_2 GST_N GST_N_3 GST_C_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: BBF64336
UniProt: A0A2Z6IG62
LinkDB All DBs
Position
complement(550448..551062)
Genome map
AA seq 204 aa AA seqDB search
MKLYYSPGACSLSPHIVLNEGGFRFDKERVDLASKKTETGADYAAINPDGYVPALLLDDG
QVLTEGPAIIQYLADRVPEKKLAPPLGTLERYRLMQWLNFISTELHKGFSPLFNPQAPEE
WKAVAAAQLGRRLGTVSRQLEGKDWLLGEGFTVADAYLFTVLGWGRHVGIELEQWPVLQA
YQGRVSMRPAVQSALKAEGLLQDT
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgtattacagccccggtgcgtgttccctgtctccccatatcgtcctcaacgaa
ggcggattccgcttcgacaaggaaagggtggacctcgccagcaaaaaaacggaaaccggt
gccgactatgccgccatcaaccccgacggttacgtgcccgccctcctgctcgacgacggg
caggtgctcaccgaggggccggccatcattcagtaccttgccgatcgcgtgcccgaaaag
aagctcgccccgcccctaggcacactggagcgctaccgactcatgcagtggctcaatttc
atctccacggaactgcataagggtttttctcccttattcaatccgcaggcgcccgaggaa
tggaaggcggtggccgctgcccaactcgggcggcgcctgggcacggtcagccggcaactg
gagggcaaggactggttgctgggcgagggattcacagtggccgacgcctatctctttacg
gtattgggctggggccggcatgtgggcattgaattggagcaatggccggtgctccaggcg
tatcaggggcgggtatccatgcggccggcggtgcaatcggccctgaaggcggaagggctt
ctccaggatacctga

DBGET integrated database retrieval system