KEGG   Acidithiobacillus ferridurans: AFERRID_11510Help
Entry
AFERRID_11510     CDS       T05847                                 

Definition
(GenBank) Multidrug export protein EmrA
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
afj  Acidithiobacillus ferridurans
Brite
KEGG Orthology (KO) [BR:afj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:afj02000]
    AFERRID_11510
Transporters [BR:afj02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   AFERRID_11510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 HlyD Biotin_lipoyl DUF4131 YjbH DUF4407
Motif
Other DBs
NCBI-ProteinID: BBF64933
UniProt: A0A2Z6IMB3
LinkDB All DBs
Position
1127500..1128513
Genome map
AA seq 337 aa AA seqDB search
MRWLKRLLVLVIIVVVAFGAYAYFQISDYYPNTDDAYLHAHVVNIAPRVTGHIVAIYVHD
NQVVQAGQPLLQVDPRAYVYDVQKAEAELTQAERQTAAIQANIAGARANISADQVNYQNA
RHNAQRAAALAAQKYLSAQQADNEMTAAKSAGARLTADQAALAETQAQQVLNGARIAAAK
AALRTARLYLSETTLYAPIAGVVSKVDKIHVGDVVNVNQDLFPLIGNAEYWVEANYKETD
LSRVHPGQSAKITVDMYPDHRFKGRVISLSGGAGNAFSLLPPENATGNWVKVTQRVPVRV
LITNPDPRFPLRIGTSASVTVDTGGAPGWVKALRPIF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgctggctcaaacgccttttggttctggtcatcatcgtcgtggttgcctttggcgcc
tatgcatacttccagatttctgattactatcccaacaccgacgatgcctatctgcatgcc
catgtcgtgaacatcgcaccgcgggttacgggacatattgtcgccatttatgtgcatgat
aatcaggtcgtgcaggctggacagcccctgctccaggtggatccgcgggcctacgtctac
gacgtgcagaaagccgaggccgaactgacccaggcggaacggcagacggccgccattcag
gccaatattgccggagcgcgcgccaatatcagcgccgaccaggtcaattaccagaatgcc
cggcacaacgcccaacgcgcggcagcgctggcggcacagaaatatctatccgcgcaacag
gcggataacgaaatgaccgcggcgaaaagtgccggggcgcgcctgaccgccgatcaggcg
gccctggcggagacacaggcacagcaagtcctcaatggtgcccgcatcgccgccgccaag
gccgccctgcgcacagcccggctctatctgtctgaaaccacgctctacgcgcccatcgcg
ggagtcgtcagcaaagtggataaaatccatgtgggcgacgtggtcaatgtcaatcaagac
ctgttccccctgatcggcaatgcggaatactgggtcgaggccaactacaaggaaaccgat
cttagccgggtacacccgggacagagtgcgaaaatcactgtggacatgtaccccgaccat
cgcttcaagggaagggtgataagcctgagcggcggtgccggaaacgccttctccctgctg
cccccggaaaatgctacgggtaactgggtgaaggtgacacagcgggtaccggtgcgcgtg
ctcatcaccaatccggaccccaggttcccgctacggatcggtaccagcgcgtcggtaacg
gtggatacgggcggagcaccgggctgggtcaaggcgctgcgaccgatcttctga

DBGET integrated database retrieval system