KEGG   Acidithiobacillus ferridurans: AFERRID_12040Help
Entry
AFERRID_12040     CDS       T05847                                 

Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
afj  Acidithiobacillus ferridurans
Pathway
afj00473  D-Alanine metabolism
afj00550  Peptidoglycan biosynthesis
afj01100  Metabolic pathways
afj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:afj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AFERRID_12040
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AFERRID_12040
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AFERRID_12040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:afj01011]
    AFERRID_12040
Enzymes [BR:afj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AFERRID_12040
Peptidoglycan biosynthesis and degradation proteins [BR:afj01011]
 Precursor biosynthesis
  Amino acid ligase
   AFERRID_12040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N TTL ATP-grasp_4 ATPgrasp_YheCD ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: BBF64986
UniProt: A0A2Z6IHW8
LinkDB All DBs
Position
1181564..1182490
Genome map
AA seq 308 aa AA seqDB search
MSDLARIAVLYGGPSGEREVSLDSGRAVLQALQGLGMDAVGVDIQPAILQQQMAESGAQI
AFNVCHGAVGEDGLLQACLETLDMPYTGSGVLASALAMDKWRCKQLWRAAGLPVTDGILL
HRGGHTPDLGARFGWPLYIKPNHGGSSLGVSKVCGPAELDAALQCAFAIEEEVLCEGAVI
GHEATVGVLDGQALPPIVIETPRAFYDYTAKYLADNTRYLLPSGLGAPLDQQLQALALSA
FAELGCRDWGRVDFMVDGDGRPHLLEVNSVPGMTSHSLIPMAAKATGIGFPELCAAILRT
AQRRVKYG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatttggcccgcatagccgtactttatggaggtccctccggagagcgcgaagtc
tctctcgacagcggccgcgccgtgttgcaagccttgcaggggctgggtatggatgccgtc
ggcgtcgacatccagccggccatcctccagcagcaaatggccgaaagcggggcgcagatc
gccttcaacgtctgccatggcgcggtaggcgaagacggtctgttgcaggcctgcctggaa
actctggatatgccctacaccggcagcggggtcctcgcctccgcgctcgccatggataaa
tggcgctgcaagcagctctggcgagctgccgggttaccggtgaccgacggcatcctgctg
catcgcggcggccatacgcccgatctcggcgcccgcttcggctggcccctgtacatcaag
ccgaaccacggtggctccagcctcggggtcagcaaagtctgcggcccggcggaattggat
gcagccttacagtgcgccttcgccatcgaggaggaagtcctctgcgagggtgccgtcatc
ggtcacgaagccaccgtcggcgtcctcgatggccaagcgctgccgccgatcgtcatcgaa
acgccccgggccttctatgactacaccgccaagtatcttgccgacaatacccgttacctc
ctgccctccggcctcggcgcgccactggaccagcagttgcaggcgcttgcgctcagtgcc
tttgccgagctcggctgccgcgactgggggcgggtcgacttcatggtcgacggcgatggc
cgaccccatctgctggaagtcaacagtgtacccggcatgaccagccacagcctgattccc
atggccgccaaagccaccggcataggtttcccggaattatgcgccgccatactgcgcacc
gcgcagaggagagtgaaatatggttag

DBGET integrated database retrieval system