KEGG   Acidithiobacillus ferridurans: AFERRID_27760Help
Entry
AFERRID_27760     CDS       T05847                                 

Definition
(GenBank) ATP-dependent 6-phosphofructokinase isozyme 2
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
afj  Acidithiobacillus ferridurans
Pathway
afj00010  Glycolysis / Gluconeogenesis
afj00030  Pentose phosphate pathway
afj00051  Fructose and mannose metabolism
afj00052  Galactose metabolism
afj00680  Methane metabolism
afj01100  Metabolic pathways
afj01110  Biosynthesis of secondary metabolites
afj01120  Microbial metabolism in diverse environments
afj01130  Biosynthesis of antibiotics
afj01200  Carbon metabolism
afj01230  Biosynthesis of amino acids
Module
afj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:afj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFERRID_27760
   00030 Pentose phosphate pathway
    AFERRID_27760
   00051 Fructose and mannose metabolism
    AFERRID_27760
   00052 Galactose metabolism
    AFERRID_27760
  09102 Energy metabolism
   00680 Methane metabolism
    AFERRID_27760
Enzymes [BR:afj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AFERRID_27760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: BBF66558
UniProt: A0A2Z6ILJ3
LinkDB All DBs
Position
complement(2681762..2682721)
Genome map
AA seq 319 aa AA seqDB search
MTEISTRSPSIATLTLNPAVDIAYEVPHLIPDQKSHATSTRYDPGGNGINVARALKELLV
YAHSCCVVAGNIGELLQKLLRHQLDDPHCVHVEGETRVNATILQGDPATQFEITGIGPRV
SEPILAEVRETFLGLCKDGFAVLTGSIPPGVDDDFYGDMVDRVRAGGGQSIVDAHGALLQ
HALPHHPFLIKPNRYELSLLRRRELPTLEDVAKEARAIQREGVQYVCVSLGGDGALLAGP
DGSYFAKAPPIQVKSTVGSGDSMVAGLVAALAHGQSPAEALRLAVACGSGTAARPGTEIF
SHNDLDELLQTTEARVLDI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaatcagcacccgctccccttccatcgccaccctcaccctcaacccggccgta
gacatcgcctacgaagtgccgcacctgatcccggaccagaaaagccatgccacatccacc
cgttacgatcccggcggtaacggcatcaatgtcgcccgcgccctcaaggagctgctggtc
tacgcccatagttgctgtgtcgtggccggcaatatcggcgaattgctacagaaactgctg
cggcatcaactggatgatccgcattgcgtgcatgtggagggggaaacccgcgtcaacgcc
accattttgcagggtgaccccgccacccagtttgaaatcaccggcatcgggccgcgggtt
tcagaacctatcctcgccgaagtccgggaaacctttctgggcctgtgcaaagacggtttt
gcggtactcaccggctccatcccccctggcgtggatgatgatttctatggagacatggtc
gatcgtgtccgcgccggaggcggacaatccattgtcgatgcccatggcgccctcctgcaa
cacgcccttccccatcaccccttcctgatcaagcccaaccgctatgagctgtccctcctg
cgtcggcgcgagctccccacgctggaggatgtggcgaaggaggcgcgcgccatacagcgg
gaaggggtgcaatatgtctgcgtatccctggggggcgacggagcactgctggccggaccc
gatggcagctactttgccaaggcaccccccattcaggtgaagtcgacggtcggctctggc
gactccatggtcgctggccttgtcgccgcgctggcccacggccaaagtccggcagaggcc
ctgcgcctcgccgtcgcctgcggcagcggcacggctgcccggccgggcaccgagatattc
tcccataatgatctggacgaactgctacagacaacggaagcgcgtgtgctcgacatctga

DBGET integrated database retrieval system