KEGG   Anoxybacillus flavithermus: Aflv_0103Help
Entry
Aflv_0103         CDS       T00790                                 

Gene name
tufA
Definition
(GenBank) Translation elongation factor Tu, EF-Tu
  KO
K02358  elongation factor Tu
Organism
afl  Anoxybacillus flavithermus
Brite
KEGG Orthology (KO) [BR:afl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:afl03012]
    Aflv_0103 (tufA)
   03029 Mitochondrial biogenesis [BR:afl03029]
    Aflv_0103 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:afl04147]
    Aflv_0103 (tufA)
Translation factors [BR:afl03012]
 Eukaryotic Type
  Elongation factors
   Aflv_0103 (tufA)
 Prokaryotic Type
   Aflv_0103 (tufA)
Mitochondrial biogenesis [BR:afl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Aflv_0103 (tufA)
Exosome [BR:afl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Aflv_0103 (tufA)
  Exosomal proteins of breast cancer cells
   Aflv_0103 (tufA)
  Exosomal proteins of colorectal cancer cells
   Aflv_0103 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACJ32487
UniProt: B7GJ65
LinkDB All DBs
Position
119051..120238
Genome map
AA seq 395 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEARAYDQIDAAPEERERG
ITISTAHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDEVPVIKGSALKALE
GDPAWEAKIIELMNAVDEYIPTPQREVDKPFMMPVEDVFSITGRGTVATGRVERGILKVG
DQVEIIGLSEEPKATTVTGVEMFRKLLDQAEAGDNIGALLRGVSRDEVQRGQVLAKPGTI
TPHTKFKAQVYVLTKEEGGRHTPFFSNYRPQFYFRTTDVTGIIQLPEGVEMVMPGDNIEM
TVELIAPIAIEEGTKFSIREGGRTVGAGSVSEIIE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcgaaattcgaacgcacgaaaccacacgtcaacattggtacaatcggccac
gttgaccatggtaaaacaactttaacagctgcaatcacaacagttcttgcgaaacaaggt
aaagcagaagcacgcgcgtatgatcaaatcgacgctgctccagaagagcgcgagcgcgga
attacaatctcaactgcacacgttgagtacgaaactgacaaccgtcactatgcacacgtt
gactgcccaggtcacgctgactacgtgaaaaacatgatcacaggtgctgcgcaaatggac
ggcgcgatccttgttgtatctgcagctgacggtccaatgccacaaactcgtgagcacatt
cttctttctcgccaagtaggcgtaccttacattgttgtattcttaaacaaatgcgacatg
gtagacgacgaagagcttttagagcttgttgaaatggaagttcgcgatctattatctgaa
tacgacttccctggagacgaagttcctgtaattaaaggttctgcgttaaaagcacttgag
ggagatccagcttgggaagcaaaaatcatcgagcttatgaacgctgttgatgagtacatc
ccaactccacaacgcgaagttgacaaaccattcatgatgccagttgaggacgtattctca
atcactggtcgtggtacagttgctactggtcgcgttgagcgcggtatcttaaaagttggt
gaccaagtagaaatcatcggtctttctgaagagccaaaagcaacaactgttacaggtgtt
gaaatgttccgtaagcttcttgaccaagctgaagctggtgacaacatcggtgcgcttctt
cgcggtgtttctcgtgacgaagtacaacgcggtcaagtattagcaaaaccaggaacaatc
actccacacacaaaatttaaagcacaagtttacgtattaacaaaagaagaaggtggacgt
catactccattcttctctaactaccgtccacaattctacttccgtacaacggacgtaaca
ggtatcatccaacttccagaaggcgttgagatggtaatgcctggtgacaacatcgaaatg
acagtagaattaatcgcgccaatcgcgatcgaagaaggtacaaaattctcgatccgcgaa
ggtggacgtacagtaggtgcaggttctgtatctgaaatcatcgagtaa

DBGET integrated database retrieval system