KEGG   Anoxybacillus flavithermus: Aflv_0192Help
Entry
Aflv_0192         CDS       T00790                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00473  D-Alanine metabolism
afl00550  Peptidoglycan biosynthesis
afl01100  Metabolic pathways
afl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:afl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Aflv_0192 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Aflv_0192 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Aflv_0192 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:afl01011]
    Aflv_0192 (ddl)
Enzymes [BR:afl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Aflv_0192 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:afl01011]
 Precursor biosynthesis
  Amino acid ligase
   Aflv_0192 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: ACJ32576
UniProt: B7GJ30
LinkDB All DBs
Position
202182..203249
Genome map
AA seq 355 aa AA seqDB search
MNIRGGKNMKITLGILYGGKSPEHKVSLQTARSVINAINKEKFTVVPIYITTDGQWLRGE
AIEGEVQHVNELAFQQGLPALALIANGIDVIFPLLHGPNGEDGTVQGMLELLNVPYVGNG
VLASAVGMDKVVMKQLFAQAGLKQARYVFFLKNEWEGQKENVYETVEQEIGYPCFVKPAN
AGSSVGISKCKNREQLQTAFQEAFRYDRKVIVEEAIIGREVEIGVIGNDKPICSVVGEIV
PKKEFYDYEAKYVDGNTELFIPANVTDKEYETIKQMALAAFKVLDLAGLVRADFFLTADG
EVYINEVNTMPGFTPFSMFPLLWKHTGIPYEELIERLIQLAIERYEEKQNITYIF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcgaggaggaaaaaacatgaagataacgttaggtatactatacggcggaaaa
tcgcctgaacataaagtatctctacaaacagcacgttccgtcattaatgcgataaataaa
gaaaaatttacggtcgtgcccatttacattacgacagatggacaatggttgcgcggagaa
gcgattgaaggggaagtgcaacatgtaaacgaacttgcttttcaacaaggtttaccagcg
ctcgctttgattgcaaacggcattgatgttatttttcctcttttacacggaccgaacggg
gaagatggaacggtgcaaggcatgttagaattattaaacgtaccgtatgtcggaaacggc
gtgttagcatcagctgtcggtatggataaagtcgttatgaaacaattgtttgctcaagca
gggctaaaacaagcgcgttacgtctttttcttaaaaaatgaatgggaagggcaaaaagaa
aacgtatatgaaacggttgaacaagagattggctacccttgttttgtgaagccagccaac
gccggttcaagcgtgggcataagcaaatgtaaaaaccgtgaacaattgcaaacggcattc
caagaggcgtttcgttacgatcggaaagtcattgttgaagaagcgattatcggtcgtgaa
gtggaaattggggtaatcggaaacgataaaccaatttgttcggttgtgggggaaattgtg
ccgaaaaaagaattttacgattacgaagcaaaatatgttgatggaaatacggaattattc
atcccggcaaacgttacagataaagaatacgaaacgatcaaacaaatggcacttgccgct
tttaaagtgctcgatttagcgggattagttcgcgccgactttttcttgacagcagatgga
gaggtgtatattaacgaagtcaatacgatgccgggctttacgccatttagcatgtttccg
ctcttatggaaacatacaggtataccgtatgaggagttaattgaacgtctcattcaactt
gccatcgagcgatatgaagaaaaacaaaacattacgtatatattttaa

DBGET integrated database retrieval system