KEGG   Anoxybacillus flavithermus: Aflv_0197Help
Entry
Aflv_0197         CDS       T00790                                 

Gene name
alr
Definition
(GenBank) D-alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00473  D-Alanine metabolism
afl01100  Metabolic pathways
afl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:afl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Aflv_0197 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Aflv_0197 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:afl01011]
    Aflv_0197 (alr)
Enzymes [BR:afl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Aflv_0197 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:afl01011]
 Precursor biosynthesis
  Racemase
   Aflv_0197 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACJ32581
UniProt: B7GFP5
LinkDB All DBs
Position
207787..208944
Genome map
AA seq 385 aa AA seqDB search
MEKAFYRDTWAEIDLDAIFYNVQSMKQHVGSHVEVIAVVKANAYGHGDIQVAKTALEAGA
TRLAVAFLDEALALRKKGISLDVPILVLGATKPQYAPLAASQNIALTVFRADWFEQAIVY
APYEQPLNVHMKLDTGMGRLGAKTKEEVQQMIYAIEQHPSFILEGVYTHFATADEQNIDY
FSFQYDTFLHMLEWLSIQPPLIHCANSAAGLRYPDRIFNAVRFGISMYGLAPSQEMKSLL
PYPLKEAFSLHSRLTHVKKVKGGEKISYGATYEAETDEWIGTVPIGYADGWLRRMQHFSV
LVDGKRAPIVGRVCMDQMMIRLPYELPVGTKVTLIGEQQGDRISVDDVAAHVNTINYEIP
CTISYRVPRIFLKNKSIIEVRNAVL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagcattttaccgcgatacatgggcagagattgatttagatgcgattttttat
aacgtacagtcaatgaaacagcatgttggatctcacgttgaagtcattgctgtcgtgaag
gcgaacgcttatggacatggggatattcaggtggcgaaaacagcgcttgaagcaggtgca
acacgtttagccgtcgcttttttagacgaagcgctcgctttaagaaaaaaaggcatttct
ttagacgtaccgattctcgtacttggggcaacaaaacctcaatatgcgccgttagccgct
agtcaaaacattgcgctcactgtttttcgggcggattggtttgaacaggcgatcgtgtat
gccccgtatgaacaaccgttgaacgttcacatgaagttagatacagggatggggcgatta
ggagcgaaaacaaaagaagaagtgcagcaaatgatatacgcaatcgaacagcatcctagt
ttcatactcgaaggagtatacacacattttgcaacagctgatgaacaaaatatagactat
ttttcgtttcaatatgatacgtttctacacatgctagaatggttgtcgattcagccaccg
ctcattcattgcgccaatagtgcagcaggactacgttatcccgatcgtatattcaatgcg
gttcgtttcggtatctcaatgtacggattagcaccgtcgcaagaaatgaaatcattgtta
ccttatccgttaaaagaagcgttttcgcttcacagtcgcttaacgcatgtaaaaaaagtg
aaaggcggagaaaaaataagttacggagcgacatatgaagcggagacggatgaatggatc
ggcacagttccgatcggttatgctgacgggtggttacgtcggatgcaacatttttctgtg
ctcgttgatggaaaacgtgccccaattgttggacgggtttgtatggaccaaatgatgatt
cgtttgccgtatgagcttcctgtcggtacaaaagtgacgctcatcggtgaacaacaaggg
gaccgtatttccgttgatgacgttgccgcgcatgtaaatacgattaattatgaaattcct
tgtacaattagttatcgtgttccccgtatttttttaaaaaacaagagtataattgaagtg
agaaatgcggtattatag

DBGET integrated database retrieval system