KEGG   Anoxybacillus flavithermus: Aflv_0505Help
Entry
Aflv_0505         CDS       T00790                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00020  Citrate cycle (TCA cycle)
afl00480  Glutathione metabolism
afl01100  Metabolic pathways
afl01110  Biosynthesis of secondary metabolites
afl01120  Microbial metabolism in diverse environments
afl01130  Biosynthesis of antibiotics
afl01200  Carbon metabolism
afl01210  2-Oxocarboxylic acid metabolism
afl01230  Biosynthesis of amino acids
Module
afl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
afl_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:afl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aflv_0505 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Aflv_0505 (icd)
Enzymes [BR:afl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Aflv_0505 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACJ32889
UniProt: B7GGT7
LinkDB All DBs
Position
542954..544243
Genome map
AA seq 429 aa AA seqDB search
MEVVIVMQGEKITVTNGVLNVPNYPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGERK
IVWKEVLAGEKAFKLTGEWLPQETLDTIREYIIAIKGPLTTPVGGGIRSLNVALRQELDL
FVCLRPVRYFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTPEVRKLIDFLQNEMG
VRKIRFPETSGIGIKPISEEGTKRLVRAAIKYAIEHGRKSVTLVHKGNIMKYTEGAFKNW
GYELAEQEFGDQVFTWAEYDRIVETHGKEAANRAQAEAEAAGKIIVKDAIADIFLQQILT
RPREFDVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLD
KVNPSSVILSGVMMFEHLGWNEAAKLIVDSMEKTIASKVVTYDFARLMEGATEVKCSEFA
DALIRNMGE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
ttggaggtcgttattgtgatgcaaggtgaaaaaattacggttacaaacggggtattaaac
gttccaaactatccgattattccatttattgaaggggacgggacaggtccagatatttgg
gcagccgcatctcgcgtattagaagcggctgtggaaaaagcttataaaggggagcgcaaa
atcgtttggaaagaagtgcttgctggtgaaaaagcgtttaagttgactggtgaatggttg
ccacaagaaacgcttgatacgattcgtgaatacataattgccattaaaggaccgctgaca
acaccagtaggcggtggaattcgttcattaaacgttgcgcttcgtcaagagctcgattta
tttgtgtgcttacgcccagttcgttattttaaaggagtaccgtctccggtaaagcgtccg
gaagatacagacatggtgattttccgtgaaaatacggaagacatttatgcgggaattgag
tatgcaaaaggaacaccagaagtgagaaaattaattgatttcttgcaaaatgaaatgggt
gtgcgtaaaattcgcttccctgaaacatcgggaatcggtattaaaccaatttcagaagaa
ggtacgaaacgattagtgcgcgcagcaattaaatacgccattgaacatggtcgcaaatct
gtcacgctcgttcataaaggaaacattatgaaatatacagaaggtgcgttcaaaaactgg
ggctatgaattagctgagcaagaattcggtgatcaagtgtttacttgggctgagtatgac
cgcatcgttgaaacgcacggaaaagaagctgcaaaccgcgcacaagcagaagcagaagca
gcaggaaaaatcatcgtgaaagatgcgattgcagatattttcttgcaacaaattttaact
cgtccgcgcgagttcgatgttgttgcaacaatgaacttaaacggtgactacatttctgat
gcgttggcagcacaagtgggtggcatcggtattgcaccaggcgcaaacattaactatgaa
acaggacatgcgatctttgaagcaacgcacggaactgcaccaaaatatgcgggattggat
aaagtaaatccatcgtcggtcatcttatctggtgtcatgatgtttgaacatcttggttgg
aatgaggcggcaaaactgatcgttgactctatggagaagacgattgcctcaaaagtcgtc
acatatgactttgctcgtttgatggaaggcgcaacagaagtgaaatgttcggaattcgca
gatgctctcattcgaaacatgggagaataa

DBGET integrated database retrieval system