KEGG   Anoxybacillus flavithermus: Aflv_0941Help
Entry
Aflv_0941         CDS       T00790                                 

Gene name
accC
Definition
(GenBank) Biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00061  Fatty acid biosynthesis
afl00620  Pyruvate metabolism
afl00640  Propanoate metabolism
afl01100  Metabolic pathways
afl01110  Biosynthesis of secondary metabolites
afl01120  Microbial metabolism in diverse environments
afl01130  Biosynthesis of antibiotics
afl01200  Carbon metabolism
afl01212  Fatty acid metabolism
Module
afl_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:afl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Aflv_0941 (accC)
   00640 Propanoate metabolism
    Aflv_0941 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Aflv_0941 (accC)
Enzymes [BR:afl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Aflv_0941 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Aflv_0941 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 GARS_A ATP-grasp_5 Oxidored_nitro ATPgrasp_Ter LAL_C2
Motif
Other DBs
NCBI-ProteinID: ACJ33317
UniProt: B7GHF6
LinkDB All DBs
Position
949960..951312
Genome map
AA seq 450 aa AA seqDB search
MIKKLLIANRGEIAVRIIRACKELGIETVAVFSEADREALHVQLADEAYCIGPKTSKDSY
LNFTNIMSVATLTQCDAIHPGYGFLAENADFAELCRECNVTFVGPSPEAITKMGTKDVAR
ETMRQAGVPIVPGSQGIIESMDEAIALANEIGYPVIIKATAGGGGKGIRVARNEQELIKG
ITITQQEAATAFGNPGVYIEKYIEDFRHVEIQVLADSYGNVIHLGERDCTIQRRLQKLLE
ETPSPVLDEDMRQKMGEAAVKAAQAVQYTGAGTVEFIYDYRNRQFYFMEMNTRIQVEHPV
TEMVTGVDLIKEQIRVASGEKLTLKQEDVKFNGWSIECRINAENPAKNFMPSAGKIQMYL
PPGGFGVRVDSAAYPGYTIPPYYDSMIAKLIVHAPTREEAIARMKRALSEFVIEGVHTTI
PFHLKLLEHEKFVEGNFNTKFLETYDVMNS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaattgttaatcgccaatcgtggggaaattgctgttcgaattattcgggcg
tgcaaagaacttggcatcgagacggttgctgtattttctgaggcggatcgtgaagcgctt
catgttcaattagcagacgaagcatattgtatcggtccaaaaacgtctaaagacagctat
ttaaatttcacaaacatcatgagcgtggcaacgttaacccaatgtgacgccattcaccca
ggatatggttttttagctgaaaatgctgattttgctgaactgtgccgtgagtgtaacgta
acgtttgtcggaccaagtccggaagcgattacaaaaatgggaacgaaagatgttgcacgt
gaaacgatgagacaagctggggttccgatcgttcctggttcacaaggaatcattgaaagc
atggacgaggcaattgcgctagcgaacgaaatcgggtatcctgttattattaaggcaact
gcaggtggcggtggaaaaggcattcgagtcgctcgaaatgagcaagagctcattaaagga
attacgatcacacaacaagaagcagcaacagcgtttggaaatccaggggtatatattgaa
aaatacatcgaagattttcgtcatgtggagattcaagtgttagccgattcatatgggaat
gtgattcatcttggtgagcgcgattgtacaattcaacgtcgtttacaaaaattgctcgaa
gaaacaccatcccctgtgcttgacgaagatatgcgtcaaaaaatgggggaagcagctgtc
aaagcagcgcaagccgttcaatacaccggggcaggaacagttgaatttatttacgattat
cgcaatcgtcagttttattttatggaaatgaacacgcgcatccaagtagaacatcctgtg
acggaaatggtgacaggtgtcgatttaattaaagaacaaattcgcgttgcctctggtgag
aaattaacgttgaaacaagaagatgtgaagtttaacggttggtctatcgaatgccgtatt
aatgcggaaaaccctgcgaaaaactttatgccatcggctgggaaaattcaaatgtacttg
cctccagggggatttggtgtgcgagtggattctgctgcttatccaggttatacgattccg
ccgtattacgattcgatgattgccaaactgatcgttcatgcaccgacgcgcgaagaagcg
atcgcacgcatgaaacgcgcattgagtgagtttgttattgaaggagttcatacgacgatt
ccgtttcatttgaaattgctcgagcatgaaaagtttgtcgaaggaaactttaatacaaag
tttttagaaacatacgatgtaatgaactcttaa

DBGET integrated database retrieval system