KEGG   Anoxybacillus flavithermus: Aflv_1604Help
Entry
Aflv_1604         CDS       T00790                                 

Gene name
dhaS
Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00010  Glycolysis / Gluconeogenesis
afl00620  Pyruvate metabolism
afl01100  Metabolic pathways
afl01110  Biosynthesis of secondary metabolites
afl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:afl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aflv_1604 (dhaS)
   00620 Pyruvate metabolism
    Aflv_1604 (dhaS)
Enzymes [BR:afl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Aflv_1604 (dhaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACJ33969
UniProt: B7GJV6
LinkDB All DBs
Position
1602622..1604148
Genome map
AA seq 508 aa AA seqDB search
MNMIFAQPGQPGSLITFKKRYENFIGGEWVPPIDGEYFENISPVTGQVYCEVPRSKAADI
ELALDAAHAAKESWGRTSVAERARLLNKIADRMEEHLDMLAVAETWENGKPIRETRAADI
PLAIDHFRYFAGCIRAEEGTLAELDNDTVSYHFKEPLGVVGQIIPWNFPILMAAWKLAPA
LAAGNCVVLKPAEQTPTSILVLIELIQDLLPKGVVNVVNGFGLEAGKPLASNPRIAKVAF
TGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVATKDDEFFDKALEGFTMFALNQG
EVCTCPSRALIEESIYDLFMERALERVKQIKQGNPLDTTTMVGAQASSEQLEKILSYIDI
GKQEGAELLIGGERNMLEGDLQGGYYVKPTVFKGHNRMRIFQEEIFGPVVSVTTFKDKDE
ALSIANDTLYGLGAGVWTRDVNTAYRFGRGIQAGRVWTNCYHAYPAHAAFGGYKMSGIGR
ETHKMMLEHYQQTKNLLVSYSPKKLGFF
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgatttttgctcaacctggacaaccagggtcacttattacatttaaaaaaaga
tacgaaaatttcatcggtggagaatgggtacctcctatcgacggtgaatattttgaaaat
atttcgccagttactggacaagtatattgtgaagttcctcgttcgaaagcggctgacatt
gaattagcactcgatgctgcacatgctgcaaaagaatcatggggacgcacatctgtcgct
gaacgagcacgcttgttaaacaaaatcgctgatcgaatggaagaacacttagacatgctt
gcagtggcggaaacgtgggagaacggaaaaccgattcgtgaaacacgtgcagctgacatt
cctttagccattgatcatttccgttattttgctggttgcattcgtgcggaggaaggaaca
ctagcagaacttgacaacgatactgtttcttatcattttaaagagcctctcggcgttgtc
ggacaaattattccgtggaatttcccaattttaatggcagcttggaaactcgctcctgct
ttagctgctggtaactgcgtcgtgctaaaaccagctgaacaaacgccaacatccattctc
gtactgattgaactcatccaagacttgctaccaaaaggcgtcgtcaacgttgtcaacgga
tttggtcttgaagccggcaaaccgctcgcttcgaaccctcgcatcgcaaaagttgccttt
accggcgaaacgacgactgggcgtctcattatgcaatatgcatctcaaaatttaatccct
gttacacttgaactcggcggaaagtcaccaaacattttcttcgctgacgttgctacaaaa
gatgatgaattttttgataaagcactagaaggttttacgatgtttgcattaaatcaaggg
gaagtttgtacatgcccttcacgcgcgttaatcgaagaatccatttacgatttgtttatg
gagcgtgcattagagcgagtgaaacaaattaaacaaggaaatccactcgacacaacgaca
atggttggcgctcaagcctcatccgaacagctagagaaaattttgtcatacattgacatt
ggcaaacaagaaggtgccgaactccttattggtggcgaacgtaatatgctagaaggagat
ttacaaggtggttattatgtaaagccgactgtctttaagggacataatcggatgcgcatt
ttccaagaagaaattttcggtcccgttgtgtctgtgacgacatttaaggataaagacgaa
gcgttatcgattgccaacgatacattatacggattaggggctggcgtatggacgcgtgat
gtgaatacagcatatcgcttcggtcgcggcattcaagctggacgtgtttggacgaattgt
tatcacgcttacccggcacatgcagcatttgggggatataaaatgtctggcatcggacgc
gaaacgcataaaatgatgcttgaacattaccaacaaacaaaaaacttactcgttagctac
tcaccaaaaaaacttgggttcttttaa

DBGET integrated database retrieval system